S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein CG7878 DDX53
CAGE
Database Links
Cellular Function

Group Alignment

Q86TM3|DDX53_HUMAN               MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWSGPFGHQGPRAAGSREPP
Q7K4L8|DDX53_DROME_LD33749p      ------------------DYGGGRRDNRDNYGAGHRDSRDSAGGGGGDFS
                                                   . . . *..*..  :*  . :.. ..*. : .
 
Q86TM3|DDX53_HUMAN               LCFKIKNNMVGVVIGYSGSKIKDLQHSTNTKIQIINGESEAKVRIFGNRE
Q7K4L8|DDX53_DROME_LD33749p      ESLSIASEMVGKVIGRGGSNISRIQNDFNVRVKLDKCDLIVKITGSIQSN
                                  .:.* .:*** *** .**:*. :*:. *.:::: : :  .*:    : :
 
Q86TM3|DDX53_HUMAN               MKAKAKAAIETLIRKQESYNSESSVDNAASQTPIG---------------
Q7K4L8|DDX53_DROME_LD33749p      VIDAINHVRKQVTNSGDRGQDRDNRDHGSNERYDGGGYDRYKGNSYEFNP
                                 :    : . : : .. :  :.... *:.:.:   *               
 
Q86TM3|DDX53_HUMAN               RNLGRNDIVGEAEPLSNWDRIRAAVVECEKRKWADLPPVKKNFYIESKAT
Q7K4L8|DDX53_DROME_LD33749p      TSSESNKDNGDLTGIIDWEALNKASIAATAARWSKCPPLTKNFYKEAPEV
                                  .   *.  *:   : :*: :. * : .   :*:. **:.**** *:  .
 
Q86TM3|DDX53_HUMAN               SCMSEMQVINWRKENFNITCDDLKSGEKR----LIPKPTCRFKDAFQQYP
Q7K4L8|DDX53_DROME_LD33749p      ANLTKSEIERIREENNKITVSYVFEPKEGETSPPIPNPVWTFEQCFAEYP
                                 : ::: :: . *:** :** . : . ::      **:*.  *::.* :**
 
Q86TM3|DDX53_HUMAN               DLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGF
Q7K4L8|DDX53_DROME_LD33749p      DMLEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFLLPGM
                                 *:*:.* ::*: **:*********:*** *:* :*********::*:**:
 
Q86TM3|DDX53_HUMAN               IHLDSQPISREQRNGPGMLVLTPTRELALHVEAECSKYSYKGLKSICIYG
Q7K4L8|DDX53_DROME_LD33749p      IHTEYQSTPRGTRGGANVLVLAPTRELALQIEMEVKKYSFRGMKAVCVYG
                                 ** : *. .*  *.*..:***:*******::* * .***::*:*::*:**
 
Q86TM3|DDX53_HUMAN               GRNRNGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKM
Q7K4L8|DDX53_DROME_LD33749p      GGNRNMQISDLERGAEIIICTPGRLNDLIMANVIDVSTITYLVLDEADRM
                                 * *** **.*:.:*.:***.******** * * ::: :*****:****:*
 
Q86TM3|DDX53_HUMAN               LDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYVG
Q7K4L8|DDX53_DROME_LD33749p      LDMGFEPQIRKVMLDIRPDRQTIMTSATWPPGVRRLAQSYMKNPIQVCVG
                                 *** *******::**:******:*******  **:** **:*:*: * **
 
Q86TM3|DDX53_HUMAN               NLNLVAVNTVKQNIIVTTE-KEKRALTQEFVENMSPNDKVIMFVSQKHIA
Q7K4L8|DDX53_DROME_LD33749p      SLDLAATHSVKQIIKLMEDDMDKFNTITSFVKNMSSTDKIIIFCGRKVRA
                                 .*:*.*.::*** * :  :  :*     .**:***..**:*:* .:*  *
 
Q86TM3|DDX53_HUMAN               DDLSSDFNIQGISAESLHGNSEQSDQERAVEDFKSGNIKILITTDIVSRG
Q7K4L8|DDX53_DROME_LD33749p      DDLSSELTLDGFMTQCIHGNRDQMDREQAIADIKSGVVRILVATDVASRG
                                 *****::.::*: ::.:*** :* *:*:*: *:*** ::**::**:.***
 
Q86TM3|DDX53_HUMAN               LDLNDVTHVYNYDFPRNIDVYVHRVGYIGRTGKTGTSVTLITQRDSKMAG
Q7K4L8|DDX53_DROME_LD33749p      LDIEDITHVINYDFPHNIEEYVHRVGRTGRAGRQGTSISFFTREDWAMAK
                                 **::*:*** *****:**: ******  **:*: ***::::*:.*  ** 
 
Q86TM3|DDX53_HUMAN               ELIKILDRANQSVPEDLVVMAEQYKLNQQKRHRETRSR----------KP
Q7K4L8|DDX53_DROME_LD33749p      ELIEILQEAEQEVPDELHNMARRFKAMKDKRAAEGGGFGGRGGRFGGGRG
                                 ***:**:.*:*.**::*  **.::*  ::**  *  .           : 
 
Q86TM3|DDX53_HUMAN               GQRRKEFYFLS
Q7K4L8|DDX53_DROME_LD33749p      GGRRNFDQFQY
                                 * **:   *