S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein C46F11.4 CG6418 DDX42 DDX42
SF3b125
Database Links
Cellular Function pre-mRNA splicing

Group Alignment

Q86XP3|DDX42_HUMAN             --------------------------------------------------
Q810A7|DDX42_MOUSE             --------------------------------------------------
Q9VTC1|DDX42_DROME             MSGYRGIGGGGFPYRKPASSGNNMNAVPPPPMLNARGYSGSRGGFGGASR
Q93382|DDX42_Q93382_CAEEL      -------------MWRGKYSGGYQNRFVSAKSSGTSSLSDGKSMNNVPPP
                                                                                 
 
Q86XP3|DDX42_HUMAN             ----------------------------KIGSKRANFDEENAYFEDEEED
Q810A7|DDX42_MOUSE             ----------------------------KIGSKRANFDEENAYFEDEEED
Q9VTC1|DDX42_DROME             GGVTGSTTSTSKHGYSTLDSISQYTNATNLVGKRKHHTDDDYFDDDDEPR
Q93382|DDX42_Q93382_CAEEL      AALTVGNAPVPPPNRNILLSNRKEQEMKKEQEYANLMAYGSTSEKQSRRK
                                                           :           .   .:..  
 
Q86XP3|DDX42_HUMAN             SSNVDLPYIPAENSPTRQQFHSKP-VDSDSDDDPLEAFMAEVEDQAARDM
Q810A7|DDX42_MOUSE             SSNVDLPYIPAENSPTRQQFHSKP-ADSDSDDDPLEAFMAEVEDQAARDM
Q9VTC1|DDX42_DROME             EKEIEQAYIPAPGSPGAPPTSAKKQEDSDSDEDPLEQFMAGINQQVEKEK
Q93382|DDX42_Q93382_CAEEL      RIYDDEYLEGGSDDEKPASSSSKLAADDDDEEDELDAFMAGIEKQASSDK
                                   :     . ..       :*   *.*.::* *: *** ::.*.  : 
 
Q86XP3|DDX42_HUMAN             KRLEEKDKERKNVKGIRD---------DIEEEDDQEAYFRYMAENPTAGV
Q810A7|DDX42_MOUSE             KRLEEKDKERKNVKGIRD---------DIEEEDDQEAYFRYMAENPTAGV
Q9VTC1|DDX42_DROME             RQQAPKPP----TQAVRG---------DIDDEDDEESYYRYMKENPNAGL
Q93382|DDX42_Q93382_CAEEL      KVSEQKEKDRKEGKDTEDPSKKGLGRADIDEEDMQESLFKFMEEYKEK--
                               :    *       :  ..         **::** :*: :::* *      
 
Q86XP3|DDX42_HUMAN             VQEEEEDNLEYDSDGNPIAPTKK-IIDPLPPIDHSEIDYPPFEKNFYNEH
Q810A7|DDX42_MOUSE             VQEEEEDNLEYDSDGNPIAPSKK-IIDPLPPIDHSEIDYPPFEKNFYNEH
Q9VTC1|DDX42_DROME             RDEGSDQEIEYDEDGNPIAPPKKKDIDPLPPIYHSEIEYEPFEKNFYTQH
Q93382|DDX42_Q93382_CAEEL      -HENDDEQLEYDEDGNIIWSWKK-VIDPLPDIDHSQIQYQKFNKNFYEEH
                                .* .::::***.*** * . **  ***** * **:*:*  *:**** :*
 
Q86XP3|DDX42_HUMAN             EEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKS
Q810A7|DDX42_MOUSE             EEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKS
Q9VTC1|Q9VTC1_DROME.           DDIAALDDEQVRELRRTLGVKVTGPSPPKPVTSFGHFGFDEQLIKAVRKA
Q93382|DDX42_Q93382_CAEEL      EDIKRLHYMDVIRLQNTMNLRVGGLKPPRPVCSFAHFSFDKLLMEAIRKS
                               ::*  *   ::  *:..:.::* *  **:*  **.**.**: *:. :**:
 
Q86XP3|DDX42_HUMAN             EYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKEL
Q810A7|DDX42_MOUSE             EYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKEL
Q9VTC1|DDX42_DROME             EYTQPTPIQAQAVPTALSGRDIIGIAKTGSGKTAAFIWPMLMHVMDQKQL
Q93382|DDX42_Q93382_CAEEL      EYEQPTPIQAMAIPSALSGRDVLGIAKTGSGKTAAYLWPAIVHIMDQPDL
                               ** ******. .:* ******::************::** ::*:*** :*
 
Q86XP3|DDX42_HUMAN             EPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQA-
Q810A7|DDX42_MOUSE             EPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQA-
Q9VTC1|DDX42_DROME             KPGDGPIGLILAPTRELSLQIYNEAKKFGKVYNLNVVCCYGGGSKWEQS-
Q93382|DDX42_Q93382_CAEEL      KAGEGPVAVIVVPTRELAIQVFQEAKKFCKVYNINPICAYGGGSKWEQSN
                               :.*:**:.:*: *****. *:. *.*:* *.**:. :. ***** ***: 
 
Q86XP3|DDX42_HUMAN             KALQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQ
Q810A7|DDX42_MOUSE             KALQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQ
Q9VTC1|DDX42_DROME             KALEQGAEIIVATPGRMIDMVKMKATNLRRVTFLVLDEADRMFHMGFEPQ
Q93382|DDX42_Q93382_CAEEL      ELQNEGAEMVVCTPGRIIDLVKMGATNFLRTTFLVFDEADRMFDMGFEAQ
                               :  ::***::*.****:** **  ***: *.::**:*******.**** *
 
Q86XP3|DDX42_HUMAN             VRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANED
Q810A7|DDX42_MOUSE             VRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANED
Q9VTC1|DDX42_DROME             VRSICNHVRPDRQCLMFSATFKKRIERLARDVLSDPVRIVQGDLNEANQD
Q93382|DDX42_Q93382_CAEEL      VKSISDHVRPDRQCLMFSATFKQKVERLARDALVDPVRIVQGEVGEANAD
                               *:**..******* *:*****::::*:**** * **:*:***::.*** *
 
Q86XP3|DDX42_HUMAN             VTQIVEILHSGPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELANNLKQ
Q810A7|DDX42_MOUSE             VTQIVEILHSGPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELASNLKQ
Q9VTC1|DDX42_DROME             ITQSVYVFPNPLQKWNWLLCHLVKFLSEGSVLIFVTKKVDAETVSNNLLI
Q93382|DDX42_Q93382_CAEEL      IEQKVFVMQNQDVKLHWLIRNLVEFASLGKVLIFVTKKLDSEDVAKKLKM
                               : * * :: .   * :**  .**:* * *.**:***** ::* ::.:*  
 
Q86XP3|DDX42_HUMAN             EGHNLGLLHGDMDQSERNKVISDFKKKDIPVLVATDVAARGLDIPSIKTV
Q810A7|DDX42_MOUSE             EGHNLGLLHGDMDQSERNKVISDFKKKDIPVLVATDVAARGLDIPSIKTV
Q9VTC1|DDX42_DROME             KEYNCLLLHGDMDQADRNKVITQFKRKECDILVATDVAARGLDIPHIRNV
Q93382|DDX42_Q93382_CAEEL      KDFDIVLLHGDMLQAERNENLLKFRKK-SQILVATDVAARGLDISEIRTV
                               : .:  ****** *::**: : .*::*   :*************. *:.*
 
Q86XP3|DDX42_HUMAN             INYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVRNLEGA
Q810A7|DDX42_MOUSE             INYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVRNLEGA
Q9VTC1|DDX42_DROME             VNYDTARDIETHTHRIGRTGRAGEKGNAYTLVTDKDKEFAGHLVRNLEGA
Q93382|DDX42_Q93382_CAEEL      INFDMARDIDTHVHRIGRTGRAGHKGTAYTLVTEKDIEMVGHLVKNLESV
                               :*:* ****:**.**********.** ****:* ** ::.*.**:***..
 
Q86XP3|DDX42_HUMAN             NQHVSKELLDLAMQNAWFRKSRFKGGKGKKLNIGGGGLGYRERPGLGSEN
Q810A7|DDX42_MOUSE             NQHVSKELLDLAMQNAWFRKSRFKGGKGKKLNIGGGGLGYRERPGLGSEN
Q9VTC1|DDX42_DROME             DQLVPDDLMELAMKSSWFRSSRFKQGKGKRPTNTHTGLGYREKGNGGGGY
Q93382|DDX42_Q93382_CAEEL      SQEVPKPLMDLAMKSSWFRGQRAGNGGPSTGTQTRGRMGLGYTPKVRQVG
                               .* *.. *::***:.:*** .*   *  .  .     :*           
 
Q86XP3|DDX42_HUMAN             MDRGNNN-VMSN---------YEAYKPSTGAMGDRLTAMKAAFQSQYKSH
Q810A7|DDX42_MOUSE             SDRGNNNNVMSN---------YEAYKPSTGAMGDRLTAMKAAFQSQYKSH
Q9VTC1|DDX42_DROME             GSAGGSESTASVSAHSPSDGPSSKAFSSSGPATDRYTAMREAFRSQYNNQ
Q93382|DDX42_Q93382_CAEEL      GGATGAQFDPLK-------------EQKSCRGGGNQTVDGMIRNAQSFAT
                                .  . :                    .:    .. *.     .:*    
 
Q86XP3|DDX42_HUMAN             FVAASLSNQKAGSSAAGASGWTSAGSLNSVPTNSAQQGHNSPDSPVTSAA
Q810A7|DDX42_MOUSE             FVAASLSNQKAGTSSAGASGWTSAGSLNSVPTNSAQQGHNSPDNPMTSST
Q9VTC1|DDX42_DROME             FRASSDRTWEKTLPES----------------------------------
Q93382|DDX42_Q93382_CAEEL      SSSSSSSSSSGPASGANRAQMLKSAFQKSFQTTFQRPTNESSNLPQQVAS
                                 ::*  . .   . :                                  
 
Q86XP3|DDX42_HUMAN             KGIPGFGNTGNISGAPVTYPSAGAQGVNNTASGNNSREGTGGSNGKRERY
Q810A7|DDX42_MOUSE             KNIPGFNNSGNISSAPVTYPSIGAQGVNNTASGNNSREGIGGGNGKRERY
Q9VTC1|DDX42_DROME             ----------GVFAAPMAPPSSSTQGASASSANNSSNQ------------
Q93382|DDX42_Q93382_CAEEL      DPRPEWKKKVDELNAKIAQQQASSASGGSSSSSSSS--------------
                                         .   * ::  . .: . . :::...*              
 
Q86XP3|DDX42_HUMAN             TENRGSSRHSHGETGNRHSDSPRHGDGGRHGDGYRHPESSSRHTDGHRHG
Q810A7|DDX42_MOUSE             TENRGGSRHSHGDGGN------RHGDGGRHGDGYRYPESGSRHTDGHRHG
Q9VTC1|DDX42_DROME             --------------------------------------------------
Q93382|DDX42_Q93382_CAEEL      --------------------------------------------------
                                                                                 
 
Q86XP3|DDX42_HUMAN             ENRHGGSAGRHGENRGANDGRNGESRKEAFNRESKMEPKMEPKVDSSKMD
Q810A7|DDX42_MOUSE             ETRHGGSAGRHGESRGANDGRNGESRKEGFNREN----KMDPKVDSSRMD
Q9VTC1|DDX42_DROME             --------------------------------------------------
Q93382|DDX42_Q93382_CAEEL      --------------------------------------------------
                                                                                 
 
Q86XP3|DDX42_HUMAN             KVDSKTDKTADGFAVPEPPKRKKSRWDS
Q810A7|DDX42_MOUSE             KVDSKTDKTPDGFAVPEPPKRKKSRWDS
Q9VTC1|DDX42_DROME             ----------------DAKRAKKSRWN-
Q93382|DDX42_Q93382_CAEEL      ---------------------KRSRWE-
                                                    *:***: