S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein CG3561 DDX28 DDX28
Database Links
Cellular Function Mitochondrial RNA processing

Group Alignment

gi|8922976|H.S._DDX28       MALARPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQ

gi|21312584|M.M._DDX28      MALAGPSRLLALVVRLLLEPRRNLVVRGSDQSLPVVRVPRALQRRQEQRQ

gi|19920478|D.M._DDX28      --------MLNLSVVLRVQSSRHVASYATAAAAAVKTKPPKAKSKGKKQK

                                                                             

 

gi|8922976|H.S._DDX28       SRRRNLPRPVLVRPGPLLVSARRPELN-QPARLTLGRWERAPLASQGWKS

gi|21312584|M.M._DDX28      SGRGSLQRPVLVRPGPLLVSARRPELN-QPARLTLGRWERAPLASRGWKH

gi|19920478|D.M._DDX28      --------------GEPLISCRRSQFDLTQYEQTDAKFGSLSLASKGWLH

                                                             : ..     *..:   

 

gi|8922976|H.S._DDX28       RRARRDHFSIERAQQEAPAVRKLSSKGSFADLG---LEPRVLHALQEAAP

gi|21312584|M.M._DDX28      RRSRQDHFSIERVQQEAPALRNLSSRGSFVDLG---LEPRVLLALQEAVP

gi|19920478|D.M._DDX28      NKSKGDFFILNASVRGEELQQEMQTVDEFLESTGMQIHPQLLENLRVEL-

                            . :: . .  :         :: .    * :     :   :    :   

 

gi|8922976|H.S._DDX28       EVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTLSYLLPLLQRLLGQPSL

gi|21312584|M.M._DDX28      EVVQPTSVQSKTIPPLLRGRHLLCAAETGSGKTLSYLLPLFQRLLRGSDL

gi|19920478|D.M._DDX28      GIKLLTGIQKQGMPVVHGNEHCLIAAETGCGKTITYLLPIVDKLLQKEVV

                                 : :*.  :*    ... :  ****.*** :: :*:.: **    

 

gi|8922976|H.S._DDX28       DSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRI

gi|21312584|M.M._DDX28      DSRSFTAPRGLVLVPSRELAEQVQAVAQSLGGYLGLQVIELGGGLGMSRL

gi|19920478|D.M._DDX28      TERKLNTPRVLILTPGRELATQIAGVTEKLTQGTNLKVQSLLGGN--TKQ

                                  :   *:*.* **** *:    : *    .* .  : **     

 

gi|8922976|H.S._DDX28       RLQLSRQPSADVLVATPGALWKALK-SRLISLEQLSFLVLDEADTLLDES

gi|21312584|M.M._DDX28      KLQLYRRPAADVLVATPGALWKALK-SQLISLQHLNFIVLDEVDTLLDES

gi|19920478|D.M._DDX28      LMMNPQFEEVDILVATLGALSKLVT-TGIYRMEQVRHLVLDEADTLLDDT

                             :   :    .::*** * * . :  :    :: : .:::**.* :*: 

 

gi|8922976|H.S._DDX28       FLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVA

gi|21312584|M.M._DDX28      FLELVDYILEKSPIAESPAELEDPFNPKAQLVLVGATFPEGLNQLLSKVT

gi|19920478|D.M._DDX28      FTDKLSYFLRR-----FPFHLVQKEDAGTQMILASATMPTNTREILHKVI

                            *   :. :*.                   :  * .**:.    ::     

 

gi|8922976|H.S._DDX28       SPDAVTTITSSKLHCIMPHVKQTFLRLKGADKVAELVHILKHRDRAERTG

gi|21312584|M.M._DDX28      SPDSLTTITSSKLHCLMPHVRQTFMRLKGADKVTELVQILKQQDKASKTE

gi|19920478|D.M._DDX28      DVDTIREVVSPHLHRLMSHVTQKFLRLSKADRPATLLSLVKHDLAKRRP-

                               :   : *   :  : :: * :: :    : : *: :::.       

 

gi|8922976|H.S._DDX28       PSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQK

gi|21312584|M.M._DDX28      PSGTVLVFCNSASTVNWLGYILDDHKIQHLRLQGQMPASMRAGIFQSFQK

gi|19920478|D.M._DDX28      ----LIVFSNKSTTSDFVSIFLNNSGVNCLNLNGDMLMKIRLGRFEQFQN

                                 :**. ..:*   :. :* :  :: : *:*:*    * * ::.*:.

 

gi|8922976|H.S._DDX28       SSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVG---

gi|21312584|M.M._DDX28      GSQNILVCTDIASRGLDSVHVEVVINYDFPPTLQDYIHRAGRVGRVG---

gi|19920478|D.M._DDX28      GHCDVLSTTDVGSRGLDTTRARHVVNFDFPLHVSDYIHRCGRIGRVG---

                               ::*  **:.:****   .  *:*:*:*   .**:** ** .*.*  

 

gi|8922976|H.S._DDX28       ----------------------------SEVPGTVISFVTHPWDVSLVQK

gi|21312584|M.M._DDX28      ----------------------------SEVPGSVISFVTHPWDVSLVQK

gi|19920478|D.M._DDX28      ----------------------------NMDKALVTNLISSRREIDVVQR

                                                        .     *  ::    :     :

 

gi|8922976|H.S._DDX28       IELAARRRRSLPGLASSVKEPLPQAT------------------------

gi|21312584|M.M._DDX28      IELAARRRRSLPGLASSVGDPLPQKA------------------------

gi|19920478|D.M._DDX28      IEHAARTGGLLPDVNANIRNIINKRIVA------EMKAAGMPVPALGSLN

                            **         ..      : : .                         

 

gi|8922976|H.S._DDX28       ---------

gi|21312584|M.M._DDX28      ---------

gi|19920478|D.M._DDX28      GHTPQEEAF