S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein DDX21
RH II/Gu
Gu-alpha
DDX21
RH II/Gu
Database Links
Protein DDX50
RH II/Gu
Gu-beta
DDX50
Gu-beta
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

Q9NR30|DDX21_HUMAN         MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEET
sp|Q9JIK5|DDX21_MOUSE      MPGKLRSGAKLGSDGAEESMETLPKPSEKKTRKEKTKSKTEEATEGMEEA
sp|Q9BQ39|DDX50_HUMAN      MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSE----
sp|Q99MJ9|DDX50_MOUSE      MPGKLLWGDIMELEAPLEESESQRKERQKSDRRKSRHHSESEERTE----
                           *****  .  :  : . :. *:  *  ::. :::. :    :        
 
Q9NR30|DDX21_HUMAN         VFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKE
sp|Q9JIK5|DDX21_MOUSE      VSSKAKKTNKKG-PSEDDVDPPKSRKAKKQEEEPQDDTASTSKTSKKKKE
sp|Q9BQ39|DDX50_HUMAN      ---------TRENGVTDDLDAPKAKKSKMKEKLNGDTEEGFNRLS-----
sp|Q99MJ9|DDX50_MOUSE      ---------TRENGVTDDLDAPKPKKAKMREKLNGDTKEGLR-FS-----
                                    .:      *::.**.:*:* :*:   :              
 
Q9NR30|DDX21_HUMAN         PIEKKVVSSKTKKVTKN---------------------------------
sp|Q9JIK5|DDX21_MOUSE      PLEKQADSETKEIITEEPSEEEADMPKPKKMKKGKEANGDAGEKSPKLKN
sp|Q9BQ39|DDX50_HUMAN      --------------------------------------------------
sp|Q99MJ9|DDX50_MOUSE      --------------------------------------------------
                                                                             
 
Q9NR30|DDX21_HUMAN         --EEPSEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHP--------
sp|Q9JIK5|DDX21_MOUSE      GLSQPSEEEADIPKPKKMKKGKEANGDAGEKSPKLKNGLSQPSEEEVDIP
sp|Q9BQ39|DDX50_HUMAN      ---------DEFSKSHKSRRKDLPNGDIDEYEKKSKR-------------
sp|Q99MJ9|DDX50_MOUSE      ---------DEFSPSHKSRRKDLPNGDVDEYEKRSKR-------------
                                     : . .:* :: .  **:  * . : *.             
 
Q9NR30|DDX21_HUMAN         ------------------------------EPDCNPSEAASEESNSEIEQ
sp|Q9JIK5|DDX21_MOUSE      KPKKMKKGKEASGDAGEKSPRLKDGLSQPSEPKSNSSDAPGEESSSETEK
sp|Q9BQ39|DDX50_HUMAN      --------------------------------VSSLDTSTHKSSDNKLEE
sp|Q99MJ9|DDX50_MOUSE      --------------------------------VSSSENSHKSS--DKAEE
                                                            .. . :  ..  .: *:
 
Q9NR30|DDX21_HUMAN         EIPVEQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLI
sp|Q9JIK5|DDX21_MOUSE      EIPVEQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLI
sp|Q9BQ39|DDX50_HUMAN      TLTREQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLI
sp|Q99MJ9|DDX50_MOUSE      TLTREQKEGAFSNFSISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLI
                            :. **********.*****:****.***.:*****.***  **.*****
 
Q9NR30|DDX21_HUMAN         AQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVS
sp|Q9JIK5|DDX21_MOUSE      AQARTGTGKTFSFAIPLIEKLQGGLQERKRGRAPQVLVLAPTRELANQVS
sp|Q9BQ39|DDX50_HUMAN      AQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVA
sp|Q99MJ9|DDX50_MOUSE      AQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVA
                           *******************:*:   :  *:.*:*:**************:
 
Q9NR30|DDX21_HUMAN         KDFSDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGK
sp|Q9JIK5|DDX21_MOUSE      KDFSDITKKLSVACFYGGTPYGGQIERMRSGIDILVGTPGRIKDHLQNGK
sp|Q9BQ39|DDX50_HUMAN      KDFKDITRKLSVACFYGGTSYQSQINHIRNGIDILVGTPGRIKDHLQSGR
sp|Q99MJ9|DDX50_MOUSE      KDFKDITRKLSVACFYGGTSYQSQINQIRNGIDILVGTPGRIKDHLQSGR
                           ***.***:***********.* .*::::*.***************:*.*:
 
Q9NR30|DDX21_HUMAN         LDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSAT
sp|Q9JIK5|DDX21_MOUSE      LDLTKLKHVVLDEVDQMLDMGFADQVEEILCVAYKKDSEDNPQTLLFSAT
sp|Q9BQ39|DDX50_HUMAN      LDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSAT
sp|Q99MJ9|DDX50_MOUSE      LDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSAT
                           ***:**:************:***:***:*:  :**.**************
 
Q9NR30|DDX21_HUMAN         CPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVI
sp|Q9JIK5|DDX21_MOUSE      CPHWVFNVAKKYMKSTYEQVDLIGKKTQKAAITVEHLAIKCHWTERAAVI
sp|Q9BQ39|DDX50_HUMAN      CPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVI
sp|Q99MJ9|DDX50_MOUSE      CPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVI
                           **:**::******** ******:** ***:* *******:***::*.***
 
Q9NR30|DDX21_HUMAN         GDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQRE
sp|Q9JIK5|DDX21_MOUSE      GDVIRVYSGHQGRTIIFCETKKDAQELSQNTCIKQDAQSLHGDIPQKQRE
sp|Q9BQ39|DDX50_HUMAN      GDVLQVYSGSEGRAIIFCETKKNVTEMAMNPHIKQNAQCLHGDIAQSQRE
sp|Q99MJ9|DDX50_MOUSE      GDVLQVYSGSEGRAIIFCETKKNVTEMAMNPHIKQNAQCLHGDIAQSQRE
                           ***::**** :**:********:. *:: *. ***:**.*****.*.***
 
Q9NR30|DDX21_HUMAN         ITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGR
sp|Q9JIK5|DDX21_MOUSE      ITLKGFRNGNFGVLVATNVAARGLDIPEVDLVVQSCPPKDVESYIHRSGR
sp|Q9BQ39|DDX50_HUMAN      ITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIHRSGR
sp|Q99MJ9|DDX50_MOUSE      ITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIHRSGR
                           *******:*.* ********************:**.**:***********
 
Q9NR30|DDX21_HUMAN         TGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRIGVPSATEIIKASSK
sp|Q9JIK5|DDX21_MOUSE      TGRAGRTGVCICFYQNKEEYQLAQVEQKAGIKFKRIGVPSATEIIKASSK
sp|Q9BQ39|DDX50_HUMAN      TGRAGRTGICICFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSKSM
sp|Q99MJ9|DDX50_MOUSE      TGRAGRTGICVCFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSKSM
                           ********:*:**** :*. **  *******.***:****: :::*:.* 
 
Q9NR30|DDX21_HUMAN         DAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATSVDQR
sp|Q9JIK5|DDX21_MOUSE      DAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATSVDQR
sp|Q9BQ39|DDX50_HUMAN      DAIRSLASVSYAAVDFFRPSAQRLIEEKGAVDALAAALAHISGASSFEPR
sp|Q99MJ9|DDX50_MOUSE      DAIRSLASVSYAAVDFFRPSAQRLIEEKGAVDALAAALAHISGASSFEPR
                           **** * **. :*:..*: **::********:************:*.: *
 
Q9NR30|DDX21_HUMAN         SLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKG
sp|Q9JIK5|DDX21_MOUSE      SLINSQAGFVTMILRCSIEMPNISYAWKELKEQLGESIDAKVKGMVFLKG
sp|Q9BQ39|DDX50_HUMAN      SLITSDKGFVTMTLESLEEIQDVSCAWKELNRKLSSNAVSQITRMCLLKG
sp|Q99MJ9|DDX50_MOUSE      SLITSDKGFVTMTLESPEEIQDVSCAWKELNRKLSSNAVSHVTRMCLLKG
                           ***.*: ***** *..  *: ::* *****:.:*...  :::. * :***
 
Q9NR30|DDX21_HUMAN         KLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQ
sp|Q9JIK5|DDX21_MOUSE      KLGVCFDVRTEAVTEIQEKWHDSRRWQLTVATEQPELEGPQDGYRGRMGQ
sp|Q9BQ39|DDX50_HUMAN      NMGVCFDVPTTESERLQAEWHDS-DWILSVPAKLPEIEEYYDGNTSSNSR
sp|Q99MJ9|DDX50_MOUSE      NMGVCFDVPTSESERLQAEWHDS-DWILSVPAKLPEIEEYYDGNTSSNPR
                           ::****** *    .:* :****  * *:*.:: **:*   :*  .   :
 
Q9NR30|DDX21_HUMAN         REGSR-GFRGQRDGNRRFRGQ--REGSRGPRGQRSGGGNKSNRSQNKGQK
sp|Q9JIK5|DDX21_MOUSE      RDGSRGAFRGQRGGSRNFRGQGQRGGSRNFRGQRPGGGN-------RGQK
sp|Q9BQ39|DDX50_HUMAN      QRSGWSSGRSGRSGRSGGRSGGRSGRQSRQGSRSGSRQDGRRRSGNRNRS
sp|Q99MJ9|DDX50_MOUSE      QRSGWSGGRSGRSGRSGGRSGGRSGRQSRQGSRSGSRQDGRRRSGNRNRS
                           : ..  . *. *.*    *.      .    .:  .  :       :.:.
 
Q9NR30|DDX21_HUMAN         RSFSKAFGQ-
sp|Q9JIK5|DDX21_MOUSE      RSFSKAFGQ-
sp|Q9BQ39|DDX50_HUMAN      RSGGHKRSFD
sp|Q99MJ9|DDX50_MOUSE      RSGGHKRNFD
                           ** .:  .