S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Y55F3BR.1 CG9054 DDX1 DDX1
Database Links
Cellular Function

Group Alignment

gi|19527256|M.M._DDX1      MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGS

gi|6919862|H.S._DDX1       MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGS

gi|25090065|D.M._DDX1      MTAFEEFGVLPELGMATDELDWTLPTDVQAEAIPLILGGGDVLMAAETGS

gi|25148291|C.E._DDX1      MTAFEEFGIIPELSDALSSLNWTLPTAVQSEAIPAILGGADALIAAETGS

                           *:**.*:*::**:. * ..::* *** :*:*:** ****.*.*:******

 

gi|19527256|M.M._DDX1      GKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGS

gi|6919862|H.S._DDX1       GKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGS

gi|25090065|D.M._DDX1      GKTGAFCLPILQIVWETLRDLEEGKAGKGGAIGGAVTP--WTMSFFDRGN

gi|25148291|C.E._DDX1      GKTGAFSLPIAQIVWERRKSAE--KSQNSGQKPENSRE--FQLNREDRDV

                           ******.:*: ***:*  :. :  *  :            : :.  **.

 

gi|19527256|M.M._DDX1      AFAIGSDGLCCQSREVKEWHGCRGTRGLL-KGKHYYEVSCHDQGLCRVGW

gi|6919862|H.S._DDX1       AFAIGSDGLCCQSREVKEWHGCRATKGLM-KGKHYYEVSCHDQGLCRVGW

gi|25090065|D.M._DDX1      ALAVTPDGLRCQSREFKEWHGCRATTGVRGKGKFYFEATVTDEGLCRVGW

gi|25148291|C.E._DDX1      SLQIDKTGLNCESRVAKEWHGARATAGLYGNGKYYYEVTVTRDGLCRVGW

                           :: :   ** *:**  *****.*.* *:  :**.*:*.:   :*******

 

gi|19527256|M.M._DDX1      STMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDID

gi|6919862|H.S._DDX1       STMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDID

gi|25090065|D.M._DDX1      STQQANLDLGTCRMGFGFGGTGKKSNNRQFDDYGEAFGKADVIGCLLDLK

gi|25148291|C.E._DDX1      ATLSGSLKIGTDFESFGYGGTGKKSFGKKFDDYGTSFTTNDVLGCFLDLD

                           :* ...*.:**   .**:******* .::**:**  *   *.:** **:.

 

gi|19527256|M.M._DDX1      KGHVKFSKNGKDLGLAFEIPAHIKNQA--LFPACVLKNAELKFNFG-EEE

gi|6919862|H.S._DDX1       KGHVKFSKNGKDLGLAFEIPPHMKNQA--LFPACVLKNAELKFNFG-EEE

gi|25090065|D.M._DDX1      NQEVSFTKNGQNLGVAFRLPDNLAKET--FYPAVVLKNAEMQFNFG-KTD

gi|25148291|C.E._DDX1      ELKIWWSKNGVQFPVAYQIDKKFKTAATCLYPAILCQNSGLGVNFGGSAA

                           : .: ::*** :: :*:.:  :: . :  ::** : :*: : .*** . 

 

gi|19527256|M.M._DDX1      FKFPPKDGFVALSKAPDNYIVKSQHTG-NAQVSQTKFLPNAPKALIVEPS

gi|6919862|H.S._DDX1       FKFPPKDGFVALSKAPDGYIVKSQHSG-NAQVTQTKFLPNAPKALIVEPS

gi|25090065|D.M._DDX1      FKYAPGNGFVGACQAGPEHSKANPITGPAAGAPSAKPAPNAPQAIIMEPS

gi|25148291|C.E._DDX1      FKYPPGTQYVAVAQAEDGNLKW------WSAAEQLSIDSSTPLCVILEPT

                           **:.*   :*. .:*              : . . .  ..:* .:*:**:

 

gi|19527256|M.M._DDX1      RELAEQTLNNVKQFKKYIDNPKLRELLIIGGVAARDQLSVLDNGVDIVVG

gi|6919862|H.S._DDX1       RELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVG

gi|25090065|D.M._DDX1      RELAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTHIVVG

gi|25148291|C.E._DDX1      RELVQQTFQNIQTFASVLDSPKIRCVTLAAGENMNQILRTLETGCDIVVG

                           ***.:** :::: *   :..*::* : : .*   .:    *  * .****

 

gi|19527256|M.M._DDX1      TPGRLDDLVSTGKLNLSQVRFLVLDEADGLLS--QGYSDFINRMHNQIPQ

gi|6919862|H.S._DDX1       TPGRLDDLVSTGKLNLSQVRFLVLDEADGLLS--QGYSDFINRMHNQIPQ

gi|25090065|D.M._DDX1      TPGRLEEMINSGLVLLTHCRFFVLDEADALLK--QGYTELIDRLHKQIPK

gi|25148291|C.E._DDX1      TPSRVFDLIHTGKLATKNLQFVVIDEIDQFLAGKNNCAHQIESIFRVLPL

                           **.*: ::: :* :  .: :*.*:** * :*   :. :. *: :.. :*

 

gi|19527256|M.M._DDX1      ITCDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHH

gi|6919862|H.S._DDX1       VTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHH

gi|25090065|D.M._DDX1      ITSDGRRLQMVVCSATLHAFEVKKMAERLMHFPTWVDLKGEDAVPETVHH

gi|25148291|C.E._DDX1      VAQDGTRRQVIACSATLHNFEVCRFADRHMSFPQWIDLKGADCVSADVHH

                           :: ** * *::.****** *:* ::::: * ** *:**** *.*.  ***

 

gi|19527256|M.M._DDX1      VVVPVNPKTDKLWERLGKNHIR--TDDVHAKDNTRPGANSPEMWSEAIKI

gi|6919862|H.S._DDX1       VVVPVNPKTDRLWERLGKSHIR--TDDVHAKDNTRPGANSPEMWSEAIKI

gi|25090065|D.M._DDX1      VVCLVDPQMDTTWQSL-RQPIG--TDGVHDRDNVHPGNHSKETLSQAVKL

gi|25148291|C.E._DDX1      VVCHVDASEDKQWIRQMHQQVHLEDDHVHDGDQIRPGTTDKDTISLGTKI

                           **  *:.. *  *    :. :    * **  *: :**  . :  * . *:

 

gi|19527256|M.M._DDX1      LKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFMQQGGGPDKKGHQFS

gi|6919862|H.S._DDX1       LKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFS

gi|25090065|D.M._DDX1      LKGEYCVHAIDKHNMDRAIIFCRTKQDCDNLERFLRQRGG------KHYS

gi|25148291|C.E._DDX1      LKGIYVVRAIHALQMDKAIVFCRTKQQCDHMEHFLQQ---------NNLS

                           *** * *:**.  :**:**:***** :**::*::: *         :: *

 

gi|19527256|M.M._DDX1      CVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVT

gi|6919862|H.S._DDX1       CVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVT

gi|25090065|D.M._DDX1      CVCLHGDRKPQERKENLEMFKRQQVKFLICTDVAARGLDITGLPFMINVT

gi|25148291|C.E._DDX1      AACLHGDRSAEERQSSLEGFKKGIIRFLVCSDVVARGLDVQGVPFVISVT

                           ..******...**:..** **:  ::**:*:**.***:*: *:*::*.**

 

gi|19527256|M.M._DDX1      LPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYH--VCSNRGKGCY

gi|6919862|H.S._DDX1       LPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYH--VCSSRGKGCY

gi|25090065|D.M._DDX1      LPDDKTNYVHRIGRVGRAERMGLAISLVATVPEKVWYHGEWCKSRGRSCN

gi|25148291|C.E._DDX1      LPDEKSMYVHRIGRVGRAERMGLSISLVSEYEEKAWYH--KCRSRGVNCT

                           ***:*  ****************:****:   **.***   * .** .*

 

gi|19527256|M.M._DDX1      NTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVT

gi|6919862|H.S._DDX1       NTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVT

gi|25090065|D.M._DDX1      NTNLTEVRGCCIWYNEPNLLAEVEDHLNITIQQVDKTMDVPVNDFDGKVV

gi|25148291|C.E._DDX1      NTKDISKGGCTIWLQEKKMLGEIEEHLGATISTVDSDFNVPVDEFDGKVV

                           **.  .  ** ** :* ::*.*:*:**. **. *:  :.***::*****.

 

gi|19527256|M.M._DDX1      YGQKRAAGGGNYKGHVDVLAPTVQELAALEKEAQTSFLHLGYLPNQLFRT

gi|6919862|H.S._DDX1       YGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRT

gi|25090065|D.M._DDX1      YGQKNLRTGSGYEDHVEQLVPTVRKLTELELQSQSLFLKR-------LKV

gi|25148291|C.E._DDX1      YGERRTG-GANFDTHVLQLASSASQLADLETKMQLEYLNNNRHVFEIHSM

                           **::.   *..:. **  *..:. :*: ** : *  :*:          

 

gi|19527256|M.M._DDX1      F

gi|6919862|H.S._DDX1       F

gi|25090065|D.M._DDX1      -

gi|25148291|C.E._DDX1      -