S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dbp9p
YLR276C
C24H12.4 CG1666
Hlc
DDX56 DDX56
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

gi|20139152|sp|Q9D0R4|DDX56_MO      --------------------------------------------------

gi|20139238|sp|Q9NY93|DDX56_HU      --------------------------------------------------

gi|7446057|pir||T08433              --------------------------------------------------

gi|6323306|ref|NP_013378.1|[Sa      --------------------------------------------------

gi|14573856|gb|AAB71200.2|          MAPDEVTKKKRKSVKFAEEEPPKVKEAPKKQKAGKKIEVSVELRDKNEEK

                                                                                      

 

gi|20139152|sp|Q9D0R4|DDX56_MO      ------------MEDQ--------------------EALGFEHMGLDPRL

gi|20139238|sp|Q9NY93|DDX56_HU      ------------MEDS--------------------EALGFEHMGLDPRL

gi|7446057|pir||T08433              ----------MSQMTQ--------------------KTVQFHELELDQRI

gi|6323306|ref|NP_013378.1|[Sa      ----------MSYEKKSV------------EGAYIDDSTTFEAFHLDSRL

gi|14573856|gb|AAB71200.2|          MGRKRKHRMKKSQAEKRQKLMESLVGPQVDEMDFEPEHKTFADFGLDERI

                                                   .                    .   *  : ** *:

 

gi|20139152|sp|Q9D0R4|DDX56_MO      LQAVTDLGWSRPTLIQEKAIPLALEGK-DLLARARTGSGKTAAYAIPMLQ

gi|20139238|sp|Q9NY93|DDX56_HU      LQAVTDLGWSRPTLIQEKAIPLALEGK-DLLARARTGSGKTAAYAIPMLQ

gi|7446057|pir||T08433              LKAVAQLGWQQPTLIQSTAIPLLLEGK-DVVVRARTGSGKTATYALPLIQ

gi|6323306|ref|NP_013378.1|[Sa      LQAIKNIGFQYPTLIQSHAIPLALQQKRDIIAKAATGSGKTLAYLIPVIE

gi|14573856|gb|AAB71200.2|          LKSIGELGWEKANQVQESVISLALENK-NIMGRARTGSGKTGAFLIPLVQ

                                    *::: ::*:. .. :*. .*.* *: * ::: :* ****** :: :*:::

 

gi|20139152|sp|Q9D0R4|DDX56_MO      SLLHKKATGP-VMEQAVRGLVLVPTKELARQAQAMIQQLAAYCARDVRVA

gi|20139238|sp|Q9NY93|DDX56_HU      LLLHRKATGP-VVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVA

gi|7446057|pir||T08433              KILNSKLN---ASEQYVSAVVLAPTKELCRQSRKVIEQLVESCGKVVRVA

gi|6323306|ref|NP_013378.1|[Sa      TILEYKKTIDNGEENGTLGIILVPTRELAQQVYNVLEKLVLYCSKDIRTL

gi|14573856|gb|AAB71200.2|          KLIAESKTND--GSVGPSAVIIAPTKELITQIYKLFVKLSQALP-FLQAI

                                     ::  . .     .    .:::.**:**  *   :: :*       ::.

 

gi|20139152|sp|Q9D0R4|DDX56_MO      NVS-AAEDSASQRAVLMEKPDVVVGTPSRVLSHLQQNT-LKLRDSLELLV

gi|20139238|sp|Q9NY93|DDX56_HU      NVS-AAEDSVSQRAVLMEKPDVVVGTPSRILSHLQQDS-LKLRDSLELLV

gi|7446057|pir||T08433              DIADSSNDTVTQRHALSESPDIVVATPANLLAYAEAGS-VVDLKHVETLV

gi|6323306|ref|NP_013378.1|[Sa      NISSDMSDSVLS-TLLMDQPEIIVGTPGKLLDLLQTKINSISLNELKFLV

gi|14573856|gb|AAB71200.2|          NLCDINEE--ENSVWLEDRSHVVVTTPGKLLRMCSLRP--EYCTLVSYLV

                                    ::.   .:   .   * : ..::* **..:*   .          :. **

 

gi|20139152|sp|Q9D0R4|DDX56_MO      VDEADLLFSFGFEDELKSLLCHLP--RIYQAFLMSATFNEDVQTLKELVL

gi|20139238|sp|Q9NY93|DDX56_HU      VDEADLLFSFGFEEELKSLLCHLP--RIYQAFLMSATFNEDVQALKELIL

gi|7446057|pir||T08433              VDEADLVFAYGYEKDFKRLIKHLP--PIYQAVLVSATLTDDVVRMKGLCL

gi|6323306|ref|NP_013378.1|[Sa      VDEVDLVLTFGYQDDLNKIGEYLPLKKNLQTFLMSATLNDDIQALKQKFC

gi|14573856|gb|AAB71200.2|          MDEADLLLSFGYEEEMIKIRSKLP--PTYQCLMTSATLKDDMTTLKKLFM

                                    :**.**::::*::.::  :   **     * .: ***:.:*:  :*   

 

gi|20139152|sp|Q9D0R4|DDX56_MO      HNPVT-LKLQESQLPGPDQLQQFQVVCETEEDKFLLLYALLKLSLIRGKA

gi|20139238|sp|Q9NY93|DDX56_HU      HNPVT-LKLQESQLPGPDQLQQFQVVCETEEDKFLLLYALLKLSLIRGKS

gi|7446057|pir||T08433              NNPVT-LKLEEPELVPQDQLSHQRILAE-ENDKPAILYALLKLRLIRGKS

gi|6323306|ref|NP_013378.1|[Sa      RSPAI-LKFNDEEINKNQNKLLQYYVKVSEFDKFLLCYVIFKLNLIKGKT

gi|14573856|gb|AAB71200.2|          TGPVITIKLTEGDLPNSDQLTQYQLTCGSDEERFAILVAMFKLKLIVGRS

                                     .*.  :*: : ::   ::          : ::  :  .::** ** *::

 

gi|20139152|sp|Q9D0R4|DDX56_MO      LLFVNTLERGYRLRLFLEQFSIPSCVLNGELPLRSRCHIISQFNQGLYDC

gi|20139238|sp|Q9NY93|DDX56_HU      LLFVNTLERSYRLRLFLEQFSIPTCVLNGELPLRSRCHIISQFNQGFYDC

gi|7446057|pir||T08433              IIFVNSIDRCYKVRLFLEQFGIRACVLNSELPANIRIHTISQFNKGTYDI

gi|6323306|ref|NP_013378.1|[Sa      LIFVNNIDRGYRLKLVMEQFGIKSCILNSELPVNSRQHIVDQFNKNVYQL

gi|14573856|gb|AAB71200.2|          ILFVNTIDRCYKLMLILRVFGLKSCILNSAMPANSRCHVINQFNEGSYQI

                                    ::***.::* *:: *.:. *.: :*:**. :* . * * :.***:. *:

 

gi|20139152|sp|Q9D0R4|DDX56_MO      VIATD-----------------------AEILGPQV-KGKRRGRGSKGNK

gi|20139238|sp|Q9NY93|DDX56_HU      VIATD-----------------------AEVLGAPV-KGKRRGRGPKGDK

gi|7446057|pir||T08433              IIASD-----------------------EHHMEKP---GGKSATNRKSPR

gi|6323306|ref|NP_013378.1|[Sa      LIATDDTEYIKEEDDEIEEGHNTENQEEKSLEGEPE-NDKKPSKKKKVQV

gi|14573856|gb|AAB71200.2|          VIASDVSDAD-------------GSKLKEEIAGKSDEKPEKDEKKGKKAS

                                    :**:*                                   :     *  

 

gi|20139152|sp|Q9D0R4|DDX56_MO      ASDPESGVARGIDFHHVSAVLNFDLPPTAEAYVHRAGRTARANNPGIVLT

gi|20139238|sp|Q9NY93|DDX56_HU      ASDPEAGVARGIDFHHVSAVLNFDLPPTPEAYIHRAGRTARANNPGIVLT

gi|7446057|pir||T08433              SGDMESSASRGIDFQCVNNVINFDFPRDVTSYIHRAGRTARGNNKGSVLS

gi|6323306|ref|NP_013378.1|[Sa      KKDKEYGVSRGVDFKNVACVLNFDLPTTAKSYVHRVGRTARGGKTGTAIS

gi|14573856|gb|AAB71200.2|          KLDKESGVSRGIDFHHVSNVVNFDFPETTDAYIHRVGRTARGFNKGTALS

                                      * * ..:**:**: *  *:***:*    :*:**.*****. : * .::

 


gi|20139152|sp|Q9D0R4|DDX56_MO      FVLPAEQP--------FLGKIEDLLSG----EGEAP--ILLPYQFQMEEI

gi|20139238|sp|Q9NY93|DDX56_HU      FVLPTEQF--------HLGKIEELLSG----ENRGP--ILLPYQFRMEEI

gi|7446057|pir||T08433              FVSMKESK--------VNDSVEKKLCDSFAAQEGEQ--IIKNYQFKMEEV

gi|6323306|ref|NP_013378.1|[Sa      FVVPLKEFGKHKPSMLQTAKKDERILSRIIKQQSKLGLELQPYKFDQKQV

gi|14573856|gb|AAB71200.2|          FCIPSERA--------HLEQIQEEINQ----QMGRK--VLQPYEFRIKEL

                                    *    :             . :. :      :       :  *:*  :::

 

gi|20139152|sp|Q9D0R4|DDX56_MO      ESFRYRCRDAMRSVTKQAIREARLKEIKEELLHSEKLKTYFEDNPRDLQL

gi|20139238|sp|Q9NY93|DDX56_HU      EGFRYRCRDAMRSVTKQAIREARLKEIKEELLHSEKLKTYFEDNPRDLQL

gi|7446057|pir||T08433              ESFRYRAQDCWRAATRVAVHDTRIREIKIEILNCEKLKAFFEENKRDLQA

gi|6323306|ref|NP_013378.1|[Sa      EAFRYRMEDGFRAVTQVAIREARVKELKQELLASEKLKRHFEENPKELQS

gi|14573856|gb|AAB71200.2|          DTFLLRTREALSKCTKGVIKKARLKEIRQELMRSANLQTFFAKNEREKLL

                                    : *  * .:     *: .::.:*::*:: *:: . :*: .* .* ::  

 

gi|20139152|sp|Q9D0R4|DDX56_MO      LRHDLPLHPAVVKP-HLGHVPDYLVPAALRGLVHPR-------KKRRKVP

gi|20139238|sp|Q9NY93|DDX56_HU      LRHDLPLHPAVVKP-HLGHVPDYLVPPALRGLVRPH-------KKRKKLS

gi|7446057|pir||T08433              LRHDKPLRAIKVQS-HLSDMPEYIVPKALKRVVGTSSSPVGASEAKQPRQ

gi|6323306|ref|NP_013378.1|[Sa      LRHDKELHPARVQQ-HLKRVPDYLLPESARG------------NGTKVKF

gi|14573856|gb|AAB71200.2|          MQTDCHPVMLKINSPAIADVTSYMVPEALRG------------MDFSAPG

                                    :: *       ::   :  :..*::* : :                   

 

gi|20139152|sp|Q9D0R4|DDX56_MO      FS-RKAKKVKAQNPLRDFKHRGKKPKPAAKPS----

gi|20139238|sp|Q9NY93|DDX56_HU      SSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS----

gi|7446057|pir||T08433              SAAKAAFERQVNDPLMASQVDFGKRRPAHRRKKKAL

gi|6323306|ref|NP_013378.1|[Sa      VPFHNAKKRHSHKKGRVSKPKNGKVDPLKNFK----

gi|14573856|gb|AAB71200.2|          AKNRRYNMGQKHRQKLKHKFQKKGKDPLKTFKI---

                                       :     : :      :       *    .