S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dbp8p
YHR169W
H20J04.4 Dbp45A
CG12759
DDX49 DDX49
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

gi|38090904|M.M._DDX49      --------------------------------------------------

gi|12803677|H.S._DDX49      --------------------------------------------------

gi|12643712|D.M._DBP8       --------------------------------------------------

gi|6321963|S.C._DBP8        --------------------------------------------------

gi|24418257|C.E._DBP8       MSKVCDAILSDDDDDLEMDEEQEKPSTSSKSVKNEEFEEFEDGEDVEDEE

                                                                              

 

gi|38090904|M.M._DDX49      --------------------------------MAG-----FAEIGLSSWL

gi|12803677|H.S._DDX49      --------------------------------MAG-----FAELGLSSWL

gi|12643712|D.M._DBP8       --------------------------------MQRKEANPFQILGLRPWL

gi|6321963|S.C._DBP8        --------------------------------MAD-----FKSLGLSKWL

gi|24418257|C.E._DBP8       DEASDEDEEESEGEEGDEFKSSDDTPKPIQISEDNMTTKKFSQLGVCSWI

                                                                    *  :*:  *:

 

gi|38090904|M.M._DDX49      VEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQK

gi|12803677|H.S._DDX49      VEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQK

gi|12643712|D.M._DBP8       VKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILER

gi|6321963|S.C._DBP8        TESLRAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTK

gi|24418257|C.E._DBP8       TQQLQTMQIKTATPVQAACIPKILEGSDILGCARTGTGKTLAFAIPILQK

                            .:.   : :. .*.:*  *** ** * * :* *:**:*** **. *:* :

 

gi|38090904|M.M._DDX49      LSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQ

gi|12803677|H.S._DDX49      LSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQ

gi|12643712|D.M._DBP8       LSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQMVE

gi|6321963|S.C._DBP8        WSEDPSGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVIVGGESIVQQ

gi|24418257|C.E._DBP8       LSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLIHQ

                             * :* . : ::****:*** **:*** . *..: :: .:: ** . : :

 

gi|38090904|M.M._DDX49      ALELSRKPHVVIATPGRLADHLRSS--NTFN-MKKIQFLVMDEADRLLEQ

gi|12803677|H.S._DDX49      ALELSRKPHVVIATPGRLADHLRSS--NTFS-IKKIRFLVMDEADRLLEQ

gi|12643712|D.M._DBP8       SQKLMQRPHIVVAMPGRLADHLTGC--DTFS-FDNLKYLVVDEADRMLNG

gi|6321963|S.C._DBP8        ALDLQRKPHFIIATPGRLAHHIMSSGDDTVGGLMRAKYLVLDEADILLTS

gi|24418257|C.E._DBP8       ARELSERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEG

                            : .* .:**.::* *****. : .        : . :::*:**** :* 

 

gi|38090904|M.M._DDX49      GCTDFTTDLETILAAVP--ARRQTLLFSATLTDTLKELQGLATN----EP

gi|12803677|H.S._DDX49      GCTDFTVDLEAILAAVP--ARRQTLLFSATLTDTLRELQGLATN----QP

gi|12643712|D.M._DBP8       ---DFDESLSIIERCLP--KTRQNLFFSATMKDFIKESSIFPIAS---DC

gi|6321963|S.C._DBP8        ---TFADHLATCISALPPKDKRQTLLFTATITDQVKSLQNAPVQKGKPPL

gi|24418257|C.E._DBP8       ---QYNDQLKPIFESIS--EKRQTLLLSATITNNINMLHRVSTR----KP

                                :   *     .:.    **.*:::**:.: :.     .       

 

gi|38090904|M.M._DDX49      FFWEAQ--ATVRTVEQLDQRYLLVPEKVKDAYLVHLVQTFQDQLEDCSII

gi|12803677|H.S._DDX49      FFWEAQ--APVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQDEHEDWSII

gi|12643712|D.M._DBP8       FEWSQD--SDVATVETLDQRYLLCADYDRDMVLIEALRKYREENENANVM

gi|6321963|S.C._DBP8        FAYQVESVDNVAIPSTLKIEYILVPEHVKEAYLYQLLT--CEEYENKTAI

gi|24418257|C.E._DBP8       YFFEDKGKDDESTVDRLEQKYVVCPVAVKDAYLVYVVKNYSEKNPKSSVM

                            : :. .        . *. .*:: .   ::  *   :    ::  . . :

 

gi|38090904|M.M._DDX49      IFTNTCKTCQILCMMLRKFNFPTVALHSMMKQKERFAALAKFKSSIYRIL

gi|12803677|H.S._DDX49      IFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRIL

gi|12643712|D.M._DBP8       IFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTL

gi|6321963|S.C._DBP8        IFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARIL

gi|24418257|C.E._DBP8       IFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAFRSKTLQVI

                            **.:    .: *   :. : .   .**. : *::*  :*  *::.  : :

 

gi|38090904|M.M._DDX49      IATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLV

gi|12803677|H.S._DDX49      IATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLV

gi|12643712|D.M._DBP8       IATDVAARGLDIPSVELVMNHMLPRTPKEYIHRVGRTARAGRKGMSISIF

gi|6321963|S.C._DBP8        IATDVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAISFV

gi|24418257|C.E._DBP8       ICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFV

                            *.****:****** *::*:*:  *  *. :*** **:***** * ::::.

 

gi|38090904|M.M._DDX49      TQ-YDIHLLHAIEEQIKQQLAEL--VVEEAEVLQILTQVNVVRRECEIKL

gi|12803677|H.S._DDX49      TQ-YDIHLVHAIEEQIKKKLEEF--SVEEAEVLQILTQVNVVRRECEIKL

gi|12643712|D.M._DBP8       RFPRDLELLAAIEEEINTKLTEH--PIDQRMVERIFMQVNVTRRESEMQL

gi|6321963|S.C._DBP8        TQ-RDVSRIQAIEDRINKKMTETNKVHDTAVIRKALTKVTKAKRESLMAM

gi|24418257|C.E._DBP8       TQ-YDVELLQAVEQVIGKKLDEL-------KVKIQTFRKNIWKTQKSTRI

                                *:  : *:*: *  :: *         :     : .  : :    :

 

gi|38090904|M.M._DDX49      EASHFDEKKEINKRKQMILEGKDPD-----LEAKRKAELAKIKQ------

gi|12803677|H.S._DDX49      EAAHFDEKKEINKRKQLILEGKDPD-----LEAKRKAELAKIKQ------

gi|12643712|D.M._DBP8       DNNDFDERAQNYRRKTWIMEGKDPDQMEALYRKKQKDKLREIRRKRKLQH

gi|6321963|S.C._DBP8        QKENFGER----KRQ----------------QKKKQNDGKSLRS------

gi|24418257|C.E._DBP8       FNFCF---------------------------------------------

                                *                                            

 

gi|38090904|M.M._DDX49      -------------QNRRFKEKVGQTLRRQKAG--STVRRSRPPR------

gi|12803677|H.S._DDX49      -------------KNRRFKEKVEETLKRQKAG--RAGHKGRPPR------

gi|12643712|D.M._DBP8       AEPAASEEGKALLQDERFKSVDSARFEKKGKGRSRATQEDTPTKPLKRLN

gi|6321963|S.C._DBP8        --------------------------------------------------

gi|24418257|C.E._DBP8       --------------------------------------------------

                                                                             

 

gi|38090904|M.M._DDX49      -SRP-QEPAQAEAQD---

gi|12803677|H.S._DDX49      -TPSGSHSGPVPSQGLV-

gi|12643712|D.M._DBP8       KEKPVAQKGRADVKKDKA

gi|6321963|S.C._DBP8        ------------------

gi|24418257|C.E._DBP8       ------------------