S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dbp7p
YKR024C
CG8611 / BcDNA.GH02833 DDX31 DDX31
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

gi|38074599|M.m.DBP7_Ddx31          --------------------------------------------------

gi|39645219|H.S.DBP7_DDX31          --------------------------------------------------

gi|18859659|D.m.DBP7?-CG8611-P      MVENISLNVTVKSSARKNQQSPALSVKKRAQKSQDFDFQFNVDKPKVKAI

gi|15375231|C.E.DBP?-Hyp.B0511      --------------------------------------------------

gi|6322876|S.c.Dbp7p                --------------------------------------------------

                                                                                      

 

gi|38074599|M.m.DBP7_Ddx31          --------------------------------------------------

gi|39645219|H.S.DBP7_DDX31          -----------GAGSSRVPRGVPGPAVCAPGS------------------

gi|18859659|D.m.DBP7?-CG8611-P      VVRRRAPPSKVEPTNSSVPNTTKSPTPSVSSSKSAISTLSASPKANASND

gi|15375231|C.E.DBP?-Hyp.B0511      --------------------------------------------------

gi|6322876|S.c.Dbp7p                --------------------------------------------------

                                                                                      

 

gi|38074599|M.m.DBP7_Ddx31          --------------------------------------------------

gi|39645219|H.S.DBP7_DDX31          ------------------------------LLHHASPTQTMAAADGSLFD

gi|18859659|D.m.DBP7?-CG8611-P      DLMFNVSPTKPPVKSVLGDDFMLNVTTKPVVAQKAKPKITRAERLGKKQR

gi|15375231|C.E.DBP?-Hyp.B0511      --------------------------------------------------

gi|6322876|S.c.Dbp7p                ----------------------MSDEDSMLLNFTTNEDTAGSSYKQAAKV

                                                                                      

 

gi|38074599|M.m.DBP7_Ddx31          ------------MKRQAEATKRKHQVSSDAPP-------------AKRRS

gi|39645219|H.S.DBP7_DDX31          NPRTFSRRPPAQASRQAKATKRKYQASSEAPP-------------AKRRN

gi|18859659|D.m.DBP7?-CG8611-P      QGKPLTKLSEEQITRALKSNKKPKNPNQLPTPGDLFRAQLEEERRQKRRE

gi|15375231|C.E.DBP?-Hyp.B0511      ----------MGIDVKKKVLKRKLKQMKDGHE---------------KKK

gi|6322876|S.c.Dbp7p                TGGRWKDRRRMKMKLEGKTVSRKRKANTTGDEGIIP---------GRGEN

                                                     :  .:  :                       ..

 

gi|38074599|M.m.DBP7_Ddx31          EISSVLAKKASDKETQRTFKGSTHKTFP----------------------

gi|39645219|H.S.DBP7_DDX31          ETSFLPAKKTSVKETQRTFKGNAQKMFS----------------------

gi|18859659|D.m.DBP7?-CG8611-P      EGGGDQEASADEEDAKNNSGGGSPRVKPSSAVKESKKSSDIEDSGESGEE

gi|15375231|C.E.DBP?-Hyp.B0511      AKEVVVEEPMEEEDE-----------------------------------

gi|6322876|S.c.Dbp7p                SIKKLHKESSYSSEEQEKYKGRNAHNTQG---------------------

                                                .:                                   

 

gi|38074599|M.m.DBP7_Ddx31          -------PKKYLDSIGNGRQEEKPCIKTSSLFKNNP--------------

gi|39645219|H.S.DBP7_DDX31          -------PKKHSVSTSDRNQEERQCIKTSSLFKNNP--------------

gi|18859659|D.m.DBP7?-CG8611-P      SATSDEEPDESSAQSPGQEKEPKQTAKKPPKAEETSSTNRFRTKKIGLFD

gi|15375231|C.E.DBP?-Hyp.B0511      ---------EEVEEEQKHQTEESSETKVSEFLTKTT--------------

gi|6322876|S.c.Dbp7p                ---------RTLPADSQFVSSLFTSNREITTAVNTN--------------

                                             .          .     :      :.              

 

gi|38074599|M.m.DBP7_Ddx31          -----EIPELHSTVVKQAREQVFSPEAFQELDLHPHLISTINTVLKMSSM

gi|39645219|H.S.DBP7_DDX31          -----DIPELHRPVVKQVQEKVFTSAAFHELGLHPHLISTINTVLKMSSM

gi|18859659|D.m.DBP7?-CG8611-P      QSDVEALKQLGQRAVKPVKETIFTGSKISTLGLHPHAVKNLEDLLSIREL

gi|15375231|C.E.DBP?-Hyp.B0511      ------FASLEGKVNANLLKAVQG--------------------LGFTTM

gi|6322876|S.c.Dbp7p                --------IHDENVAINPSNAPLKGDQFASLGVSSLLVSHLEQKMRIKKP

                                                 .     :                        : :  

 

gi|38074599|M.m.DBP7_Ddx31          TSVQKQSIPVLLE---GRDALVRSQTGSGKTLAYCVPVVQSLQALTSKIQ

gi|39645219|H.S.DBP7_DDX31          TSVQKQSIPVLLE---GRDALVRSQTGSGKTLAYCIPVVQSLQAMESKIQ

gi|18859659|D.m.DBP7?-CG8611-P      TSVQQKTIPEVLQ---GKDVLVRSQTGSGKTLAYALPLVELLQKQQPRIQ

gi|15375231|C.E.DBP?-Hyp.B0511      TEIQAKSIDPLLE---GKDVLASAKTGSGKTLAFLLPAIELLHKLN--WK

gi|6322876|S.c.Dbp7p                TSIQKQAIPQIIGNAGKNDFFIHAQTGSGKTLSYLLPIISTILNMDTHVD

                                    *.:* ::*  ::     .* :  ::*******:: :* :. :       .

 

gi|38074599|M.m.DBP7_Ddx31          RSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGVLMGGEKRKSEKA

gi|39645219|H.S.DBP7_DDX31          RSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGVLMGGEKRKSEKA

gi|18859659|D.m.DBP7?-CG8611-P      RKDGVLALVIVPTRELVMQTYELIQKLVKPYTWIVPGSLLGGESRKSEKA

gi|15375231|C.E.DBP?-Hyp.B0511      QHNGTGVIIVSPTRELSMQTYGVLSELLE-GSNLTYGLVMGGSNRSAEKD

gi|6322876|S.c.Dbp7p                RTSGAFALVIAPTRELASQIYHVCSTLVSCCHYLVPCLLIGGERKKSEKA

                                    : .*  .::: *****  * :   . *:.    :.   ::**. :.:**

 

gi|38074599|M.m.DBP7_Ddx31          RLRKGINILISTPGRLVDHIKSTKNLHFNR---IRWLIVDEADRILDLGF

gi|39645219|H.S.DBP7_DDX31          RLRKGINILISTPGRLVDHIKSTKNIHFSR---LRWLVFDEADRILDLGF

gi|18859659|D.m.DBP7?-CG8611-P      RLRKGINILIGTPGRLVDHLLHTASFKLTK---LQFLILDEADRLLELGY

gi|15375231|C.E.DBP?-Hyp.B0511      KLAKGVSILVATPGRLLDHLQNTDNFLVRN---MKCLIIDEADRILDIGF

gi|6322876|S.c.Dbp7p                RLRKGCNFIIGTPGRVLDHLQNTKVIKEQLSQSLRYIVLDEGDKLMELGF

                                    :* ** .:::.****::**:  *  :       :: ::.**.*:::::*:

 

gi|38074599|M.m.DBP7_Ddx31          EKDITVILNAVN---AECQKR-------QNVLLSATLTEGVTRLVDISLH

gi|39645219|H.S.DBP7_DDX31          EKDITVILNAVN---AECQKR-------QNVLLSATLTEGVTRLADISLH

gi|18859659|D.m.DBP7?-CG8611-P      ERDVKQLVEAIDKQRAECEDKELP--QLQRMLLSATLTSQVQQLAGLTLK

gi|15375231|C.E.DBP?-Hyp.B0511      EIEMQQVLRHLP------KQR-------QSMLFSATHSPKVDELVKLALH

gi|6322876|S.c.Dbp7p                DETISEIIKIVHDIPINSEKFPKLPHKLVHMLCSATLTDGVNRLRNVALK

                                    :  :  ::. :       :.          :* *** :  * .*  ::*:

 

gi|38074599|M.m.DBP7_Ddx31          N-PVSISVLDKNCNQPNPKE--------------------VASIQLNSFA

gi|39645219|H.S.DBP7_DDX31          D-PVSISVLDKSHDQLNPKDK-----------AVQEVCPPPAGDKLDSFA

gi|18859659|D.m.DBP7?-CG8611-P      N-PLYIDNSDEAASAALKSKDGYQKETIEALLEVDDGLGEYQEDVTGVLS

gi|15375231|C.E.DBP?-Hyp.B0511      SNPVRVSVHEKAEEAT----------------------------------

gi|6322876|S.c.Dbp7p                DYKLISNGTKKDSDIVT--------------------------------V

                                    .  :  .  .:  .                                   

 

gi|38074599|M.m.DBP7_Ddx31          IPESLDQHVVLVPSKLRLVCLAAFILQKCKFE-------KNQKMIVFFSS

gi|39645219|H.S.DBP7_DDX31          IPESLKQHVTVVPSKLRLVCLAAFILQKCKFE-------EDQKMVVFFSS

gi|18859659|D.m.DBP7?-CG8611-P      IPENLQLSYVVVPPKLRLVALSSLLAKEVDASP------KQFKAIVFMST

gi|15375231|C.E.DBP?-Hyp.B0511      -VEGLQQGYIVAPSDKRLLLLFTFLKKN-----------KTKKVMVFFSS

gi|6322876|S.c.Dbp7p                APDQLLQRITIVPPKLRLVTLAATLNNITKDFIASGQQSKTLRTIVFVSC

                                      : *     :.*.. **: * : : :            :  : :**.*

 

gi|38074599|M.m.DBP7_Ddx31          CELVEFHYSLFLHTLLCHSGTPTSEHLPSAS-------------WPLKFL

gi|39645219|H.S.DBP7_DDX31          CELVEFHYSLFLQTLLSSSGAPASGQLPSAS-------------MRLKFL

gi|18859659|D.m.DBP7?-CG8611-P      TEMVNFHHDMLNEALTRRVLDEEDEQEKGDSD----DDGDIPLLQGLRFF

gi|15375231|C.E.DBP?-Hyp.B0511      CNSVKFHHELLNYIDIP-------------------------------CM

gi|6322876|S.c.Dbp7p                SDSVEFHYDAFSGSDGHHKNLTGDSVRLLTKGNTMFPCFSDSRDPDVVIY

                                     : *:**:. :                                      

 

gi|38074599|M.m.DBP7_Ddx31          RLHGNMEQEERTSVFHEFSHSETG------VLLCTDVASRGLDLPQVTWI

gi|39645219|H.S.DBP7_DDX31          RLHGGMEQEERTAVFQEFSHSRRG------VLLCTDVAARGLDLPQVTWI

gi|18859659|D.m.DBP7?-CG8611-P      KLHGSMTQTERQGVFRGFRDCASC------VLLATDVVGRGIDVPDIKLV

gi|15375231|C.E.DBP?-Hyp.B0511      SIHGKQKQQKRTTTFFQFCQAETG------ILLCTDVAARGLDIPAVDWI

gi|6322876|S.c.Dbp7p                KLHGSLSQQMRTSTLQHFARDNEATKGKHLIMFCTDVASRGLDLPHVGSV

                                     :**   *  *  .:  *            :::.***..**:*:* :  :

 

gi|38074599|M.m.DBP7_Ddx31          VQYSAPSSPAEYIHRIGRTAR-IGCHGSSLLILAPSE----AEYVNSLAS

gi|39645219|H.S.DBP7_DDX31          VQYNAPSSPAEYIHRIGRTAR-IGCHGSSLLILAPSE----AEYVNSLAS

gi|18859659|D.m.DBP7?-CG8611-P      VQYTPPQTTADFVHRVGRTAR-AGRKGRAVLFLTPSE----AQFVRHLEK

gi|15375231|C.E.DBP?-Hyp.B0511      VQYDPTDEPREYIHRVGRTARGTNGSGKALLVLRPEE----LGFLRYLKA

gi|6322876|S.c.Dbp7p                IELDPPFAVEDHLHRVGRTAR-AGEKGESLLFLLPGEEEKYMDYIQPYHP

                                    ::  ..    :.:**:*****  .  * ::*.* * *      ::.   

 

gi|38074599|M.m.DBP7_Ddx31          HKINVGEIKMEDILAVLAKDDCFKRRQRGAQKSRASGPQEIRERATVLQT

gi|39645219|H.S.DBP7_DDX31          HKINVSEIKMEDILCVLTRDDCFKGKRWGAQKSHAVGPQEIRERATVLQT

gi|18859659|D.m.DBP7?-CG8611-P      KRIRIQQGDMYAYLQTLLPKDDE--------------ARTVQEAASNLQH

gi|15375231|C.E.DBP?-Hyp.B0511      AKVTLNEFEFS------------------------------WSKVANIQS

gi|6322876|S.c.Dbp7p                MGWELLKFDKEILMPAFKDVNVNRNDKFIRKDEKSSKNKDVGDKEYEWDT

                                        : : .                                 .     :

 

gi|38074599|M.m.DBP7_Ddx31          -------VFEDYVHSSQRMVSWAKKALQSFIRAYATYPKELKSIFHVRAL

gi|39645219|H.S.DBP7_DDX31          -------VFEDYVHSSERRVSWAKKALQSFIQAYATYPRELKHIFHVRSL

gi|18859659|D.m.DBP7?-CG8611-P      -------KFQTLLEDDRELHDKSCKAFVSWMKFYSTFPKELKPIFNVRIA

gi|15375231|C.E.DBP?-Hyp.B0511      -------QLENLISKNYYLNKSAKEAYKCYLRAYDSHS--LKDIFDVTNM

gi|6322876|S.c.Dbp7p                NATTWHLNIERRVVGDSAFKNLAVKGFISHVRAYATHISQEKKFFNVKFL

                                            ::  :  .    . : :.  . :: * :.    * :*.*  

 

gi|38074599|M.m.DBP7_Ddx31          HLGHVAKSFGLRDAPRNLSVSAVKK--ASLKRPHPRRKTQRKQHLVPAEV

gi|39645219|H.S.DBP7_DDX31          HLGHVAKSFGLRDAPRNLSALTRKKRKAHVKRPDLHKKTQSKHSLA--EI

gi|18859659|D.m.DBP7?-CG8611-P      HMGHFAKSFALKEAPSKFAAKHAAP-KAAPPTNRLTYTERDPEKIQAQKR

gi|15375231|C.E.DBP?-Hyp.B0511      DLTAVSKSFGFSVPPFVDLPISNKP------------KVEIRSKLSGAGY

gi|6322876|S.c.Dbp7p                HLGHLAKSFGLRERPKAMGLQSSKD-------------GNSEKKPTKENS

                                    .:  .:***.:   *                        .         

 

gi|38074599|M.m.DBP7_Ddx31          LHSEHSSGLEGGATKCRKQGK---------QQGLQVAP------------

gi|39645219|H.S.DBP7_DDX31          LRSEYSSGMEADVAKVKKQNAPGEPGGRPLQHSLQPTPCFGR--------

gi|18859659|D.m.DBP7?-CG8611-P      AKRRFTTTVSGEVRQLQQRDVGAQKPGAPPPKGGFIGGGVGRSSFMKSLG

gi|15375231|C.E.DBP?-Hyp.B0511      RKKKQSFTFKAKK-------------------------------------

gi|6322876|S.c.Dbp7p                KNKMFRMARMAEKQIASEFNY-----------------------------

                                     .        .                                       

 

gi|38074599|M.m.DBP7_Ddx31          -SKPGPWRE-----------------

gi|39645219|H.S.DBP7_DDX31          -GKTLKWRKTQKGVQRDSKTSQKV--

gi|18859659|D.m.DBP7?-CG8611-P      KSRALNMSEFDSGLPPEGAAKRRKQA

gi|15375231|C.E.DBP?-Hyp.B0511      --------------------------

gi|6322876|S.c.Dbp7p                --------------------------