S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dbp6p
YNR038W
ZK686.2 DBP73D
CG9680
DDX51 DDX51
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

gi|38614333|M.M._DDX51      --MALFHIARYAGP-EAAGQGDTDAEAGS--RARVLLERLQNRARERQQR

gi|28372515|H.S._DDX51      --MALFYVARYPGPDAAAAAGPEGAEAGAHGRARALLERLQSQARERQQQ

gi|12644178|D.M._DBP6       --MELFTVNRYTEDLKEQKDGAQGTNNED-----EILQKLLKKAAKRKRK

gi|6324366|S.C._DBP6        MFASRFDPSQLTAPAASAPEGIVGTTPPA-----IVPLKRQATESDNEEY

gi|37999937|C.E._DBP6       -----MKRKNQKEDSDTENDDEIEPANGD------------GIEQEMNRV

                                 :   .          .   .                    . :.

 

gi|38614333|M.M._DDX51      EPELETTGTAGEGEAAAAGKRRRRPRRRRRVSGSATPNSEAPRAKRRKAD

gi|28372515|H.S._DDX51      R---EPAQTEAAASTEPATRRRRRPRRRRRVNDAEPGSPEAPQGKRRKAD

gi|12644178|D.M._DBP6       HEAIEVVETPILEKETSDVKE----------SESKEEQVEEPEKPLEVVQ

gi|6324366|S.C._DBP6        GSHQDSDESSNSSSEEDEDRMQVDYGASEEDSSEVEEEESKPSTHSTVLS

gi|37999937|C.E._DBP6       TNGNEDDESVGNDVAEP----------------METEDVEDSGEVEIEET

                                :   :                            . . .       

 

gi|38614333|M.M._DDX51      -KDVDAGRGEEAPEELSAG--------------AEDPGANPQ--------

gi|28372515|H.S._DDX51      GEDAGAESNEEAPGEPSAGSSEEAQGGPSAGSSEEAPGVRSTSASAEAAP

gi|12644178|D.M._DBP6       EEDVPSNEFQVLGGDDSAA-------------------------------

gi|6324366|S.C._DBP6        RFKQTVSLQERLGASDIAES-------------KEDEGIEDEAAS-----

gi|37999937|C.E._DBP6       AQNGEREIFKVLGKQEMKN-------------------------------

                              .      :    .                                  

 

gi|38614333|M.M._DDX51      -----EDVQRPPAPGRVLGDFARRKTPKVQPFLPAWLAKPSCVKKS----

gi|28372515|H.S._DDX51      DGPALEEAAGPLVPGLVLGGFGKRKAPKVKPFLPRWLAEPNCVRRN----

gi|12644178|D.M._DBP6       ------------------------KKKKVQMQLPNWLAHPTIIEGGSLQP

gi|6324366|S.C._DBP6        -----THQLKQIPQPEFVKNPMNLNTNSLQFKSTGWLNTEKIYYDN----

gi|37999937|C.E._DBP6       --------------------------LEALKVTSSWVQNATTFSAT----

                                                       .     . *:   .        

 

gi|38614333|M.M._DDX51      --VTEDLTPIEDIPEVHPDLQKQLRANGITSYFPVQAAVIPALLESADHG

gi|28372515|H.S._DDX51      --VTEDLVPIEDIPDVHPDLQKQLRAHGISSYFPVQAAVIPALLESAACG

gi|12644178|D.M._DBP6       EEEVPASEAIDQLDYLEKYTCQALKQMKIKRLFPVQKQVIPWILEAHAK-

gi|6324366|S.C._DBP6        ---SLIKPFSDYANELEAKLLQNICKNFSTNTFPIQSIILDSILPVLNFT

gi|37999937|C.E._DBP6       ----IDSSTSQKLSQIELPEHLTVPS-AISTWFPVQYAVLPSLFFEIRS-

                                      :    :.      :     .  **:*  ::  ::     

 

gi|38614333|M.M._DDX51      FLIGRGGYQ--PSDLCVSAPTGSGKTLAFVIPVVQALLHRVVCHIRALVV

gi|28372515|H.S._DDX51      FLVGRGGYR--LSDLCVSAPTGSGKTLAFVIPVVQALLSRVVCHIRALVV

gi|12644178|D.M._DBP6       ----PPPFR--PRDICVSAPTGSGKTLAFAIPIVQLLSQRVDCKVRALVV

gi|6324366|S.C._DBP6        LNVSKRNFTRRIGDILVNAATGSGKTLAYSIPIVQTLFKRQINRLRCIII

gi|37999937|C.E._DBP6       ----PPPLR--PRDVAIAAPTGSGKTICYVLPVLAAVGSKPSKILQAVIL

                                         *: : *.******:.: :*::  :  :    ::.:::

 

gi|38614333|M.M._DDX51      LPTKELAQQVSKVFNIYTDTT-PLRVALVTGQKSLAKEQESLVQKTADGF

gi|28372515|H.S._DDX51      LPTKELARQVSKVFNIYTDAT-PLRVSLVTGQKSLAKEQESLVQKTADGY

gi|12644178|D.M._DBP6       LPVAELALQVYRVISELCSKT-ELEVCLLSKQHKLEDEQEKLVEQYKGKY

gi|6324366|S.C._DBP6        VPTKLLINQVYTTLTKLTQGT-SLIVSIAKLENSLKDEHKKLSNLEP---

gi|37999937|C.E._DBP6       VPVQTLVAQIVDEFKRWNDESGVAKVVSLSGANDFEKEARQLASDPP---

                            :*.  *  *:   :.   . :    *   .  :.: .* ..* .     

 

gi|38614333|M.M._DDX51      RCLADIVVATPGRLVDHID--QTPGFSLQQLRFLIIDEADRMIDSMHQSW

gi|28372515|H.S._DDX51      RCLADIVVATPGRLVDHID--QTPGFSLQQLRFLIIDEADRMIDSMHQSW

gi|12644178|D.M._DBP6       YSKADIVVTTPGRLVDHLH--ATKGFCLKSLKFLVIDEADRIMDAVFQNW

gi|6324366|S.C._DBP6        ----DILITTPGRLVDHLN--MKS-INLKNLKFLIIDEADRLLNQSFQGW

gi|37999937|C.E._DBP6       ----NVIVATPARLVQHLTSKIPPPIDLSKLRFLIVDEADRMGKLMREEW

                                :::::**.***:*:       : *..*:**::*****: .   : *

 

gi|38614333|M.M._DDX51      LPRVVAAAFYSEGPTGSCALLQRTQPQALTAASTCVPQMPLQKLLFSATL

gi|28372515|H.S._DDX51      LPRVVAAAFQSEDPADPCALLKRRQAQAVTAASTCCPQMPLQKLLFSATL

gi|12644178|D.M._DBP6       LYHLDSHVKETTD-----QLLAGTQAPLCYAELQASFGKQPHKLLFSATL

gi|6324366|S.C._DBP6        CPKLMSHLK---------------------TDKLDTLPGNVIKMIFSATL

gi|37999937|C.E._DBP6       LDLVEFLCGGMER--------------VACLKDIIRQRRAPQKIVLSATL

                               :                                      *:::****

 

gi|38614333|M.M._DDX51      TQDPEKLQRLGLYQPRLFSTRLGQQSPKDTAEVDEN----------SGKY

gi|28372515|H.S._DDX51      TQNPEKLQQLGLHQPRLFSTGLAHRGLEDT-DGDGD----------SGKY

gi|12644178|D.M._DBP6       SQDPEKLQDLRLFQPRLFATVLTMPVLKDATEEGADTEALTDPGQFVGRY

gi|6324366|S.C._DBP6        TTNTEKLNGLNLYKPKLFLKQTDKLYQLPNKLNEFNIN------IPTAKS

gi|37999937|C.E._DBP6       SKDVEELHLWNLFKPRLFSATAVSVKDITSGIPQVD--------HVSGRL

                            : : *:*:   *.:*:**                 :           .:

 

gi|38614333|M.M._DDX51      TFPVGLTHHYVPCRLSSKPLIVLHLVLRMSCSRALCFTNSRENSHRLYLL

gi|28372515|H.S._DDX51      AFPVGLTHHYVPCSLSSKPLVVLHLVLEMGFSRVLCFTNSRENSHRLFLL

gi|12644178|D.M._DBP6       TTPAELTEQYCVTELRLKPLTVFALVEKYKWKRFLCFTNSSDQATRLTFV

gi|6324366|S.C._DBP6        VYKPLILLYSICQFMAHSPIAAKILIFVKSNESSIRLSKLLQLICESRSQ

gi|37999937|C.E._DBP6       ALPSSISHRLVVTDPKFHPLAVYQQITRNKFNRTLIFVNEVSSSNRLAHV

                            .    :            *: .   :     .  : : :  .   .   

 

gi|38614333|M.M._DDX51      AQAFGG-----VSVAEFSSRYGPGQRKKILKQFEQG----KIQLLISTDA

gi|28372515|H.S._DDX51      VQAFGG-----VDVAEFSSRYGPGQRRMILKQFEQG----KIQLLISTDA

gi|12644178|D.M._DBP6       LKVLFQKY--STKVSELSGNLSAKVRNERLRDFAAG----KINGLICSDA

gi|6324366|S.C._DBP6        SSVLKNLQNLAVSINSVNSNNSKAENKKIVANFSHHSESAGITILITTDI

gi|37999937|C.E._DBP6       LKELCKDQ---FEVDYFTAQLFGKRRYKMLEKFNKN----ENRVLICSDV

                             . :        .:  ....     .   : .*           ** :*

 

gi|38614333|M.M._DDX51      TARGIDVQGVELVINYDAPQYLRTYVHRVGRTARAGKTGQAFTLLLKVQE

gi|28372515|H.S._DDX51      TARGIDVQGVELVVNYDAPQYLRTYVHRVGRTARAGKTGQAFTLLLKVQE

gi|12644178|D.M._DBP6       LARGIDVADVDVVLSYETPRHITTYIHRVGRTARAGRKGTAVTVLTEQDM

gi|6324366|S.C._DBP6        MSRGIDINDITQVINYDPPMSSQQYVHRVGRTARANELGSAYNLLVGRGE

gi|37999937|C.E._DBP6       LARGTDLNKVDCVINYNLPADDKLFVHRAGRTGRAGQDGYVISVGDKESK

                             :** *:  :  *:.*: *     ::**.***.**.. * . .:     

 

gi|38614333|M.M._DDX51      RKFLQMVSEAGVP-ELTHHEIPRKLLQPLVARYETALSQLEKTVKEEQKL

gi|28372515|H.S._DDX51      RRFLRMLTEAGAP-ELQRHELSSKLLQPLVPRYEEALSKLEESVKEERKQ

gi|12644178|D.M._DBP6       TLFKKILSDANKG-LGEEIHVSPDIEIQHAVEYKEALAGLRSEKVKNKNQ

gi|6324366|S.C._DBP6        RTFFDDLNKDLDR-DGKSVQPLELDFTLLESDSELYTSSLESLKNYHNNT

gi|37999937|C.E._DBP6       RLFVKMLKVTNLWGDTVEEQMEEYIFEKDMDRYSKALESLKATVSSQAKT

                              *   :.           .             .     *.     . :

 

gi|38614333|M.M._DDX51      KAA-----------------------------------------------

gi|28372515|H.S._DDX51      RAA-----------------------------------------------

gi|12644178|D.M._DBP6       KMAEKNRVATKALIHKKQEETATVRPLTLMEKLQIKANEIVQSSKKSSET

gi|6324366|S.C._DBP6        AQA-----------------------------------------------

gi|37999937|C.E._DBP6       GGSRQIAKRSGFEAKRKSRPNARGEKPWLKKKTTE---------------

                              :                                               

 

gi|38614333|M.M._DDX51      -------------------------------

gi|28372515|H.S._DDX51      -------------------------------

gi|12644178|D.M._DBP6       KNSKTKADKTKYQPKETKKQIIAKQLKAIEN

gi|6324366|S.C._DBP6        -------------------------------

gi|37999937|C.E._DBP6       -------------------------------