S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dbp5p
YOR046C
DDX19
T07D4.4
DBP80 / DBP5
Hel40 / HEL80/ CG17023
DDX19
DDX19a/b
DDX19
DDX19a
Database Links
Protein DDX25 DDX25
Database Links
Cellular Function
  • RNA export
  • Translation

Group Alignment

gi|15030051|M.M._DDX19       --------------------------------------------------

gi|13477371|H.S._DDX19       --------------------------------------------------

gi|38511690|M.M._DDX25       --------------------------------------------------

gi|61222937|H.S._DDX25       --------------------------------------------------

gi|3108197|D.M._DBP5_A       --------------------------------------------------

gi|17536099|C.E._DBP5        MADWGIAFDEQCRSEGLEVPEKTEKVQSGSEMDQNEENKGSNGWGISRGG

gi|6324620|S.c._DBP5         --------------------------------------------------

                                                                              

 

gi|15030051|M.M._DDX19       --------------------------------------------------

gi|13477371|H.S._DDX19       --------------------------------------------------

gi|38511690|M.M._DDX25       --------------------------------------------------

gi|61222937|H.S._DDX25       --------------------------------------------------

gi|3108197|D.M._DBP5_A       --------------------------------------------------

gi|17536099|C.E._DBP5        MFGGPKASNAPPPQTSFGSTSGTRVGVPIMPGQSQPMRGGFQGAYRGGRG

gi|6324620|S.c._DBP5         --------------------------------------------------

                                                                               

 

gi|15030051|M.M._DDX19       -------MATDSWA--LAVDEQEAAVKSMSSLQIKEE------KVKADTN

gi|13477371|H.S._DDX19       -------MATDSWA--LAVDEQEAAVKSMTNLQIKEE------KVKADTN

gi|38511690|M.M._DDX25       -------MASLLWGGDAGAAESERLNSHFSNLVHPRKNL---RGIRSTTV

gi|61222937|H.S._DDX25       -------MASLLWGGDAGAAESERLNSHFSNLSQPRKNL---WGIKSTAV

gi|3108197|D.M._DBP5_A       -------MG--DWAK---KSEDQEVSKLVDKLN-----------------

gi|17536099|C.E._DBP5        SGGGQMDFGAPGQGQSMGRGRGQQNPAFVPRPRDTPPQYGGHQAAQQFVK

gi|6324620|S.c._DBP5         -------MSDTKRDPADLLASLKIDNEKEDTSEVS---------TKETVK

                                    :.             :                          

 

gi|15030051|M.M._DDX19       GVIKTSTTAEKTEEEEK--EDRAAQSLLNKLIRSNLVDNT-NQVEVLQRD

gi|13477371|H.S._DDX19       GIIKTSTTAEKTDEEEK--EDRAAQSLLNKLIRSNLVDNT-NQVEVLQRD

gi|38511690|M.M._DDX25       PNIDGSLNTEDDDDDEDDVVDLAANSLLNKLIRQSLIESS-HRVEVLQKD

gi|61222937|H.S._DDX25       RNIDGSINNINEDDEED-VVDLAANSLLNKLIHQSLVESS-HRVEVLQKD

gi|3108197|D.M._DBP5_A       ------LDSKSGEETDFDVADPAETSLLIKILGKGLVNTK-LSLDLQQKN

gi|17536099|C.E._DBP5        PDSKYKFTKPATEEAHEQVPVPADIALLNKFIQKEVKMMKDVVVDVQRQD

gi|6324620|S.c._DBP5         SQPEKTADSIKPAEKLVPKVEEKKTKQEDSNLISSEYEVK-VKLADIQAD

                                          :               . : .     .   :   : :

 

gi|15030051|M.M._DDX19       PSSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQN

gi|13477371|H.S._DDX19       PNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQN

gi|38511690|M.M._DDX25       PSSPLYSVKTFEELRLKEELLKGIYAMGFNRPSKIQEMALPMMLAHPPQN

gi|61222937|H.S._DDX25       PSSPLYSVKTFEELRLKEELLKGIYAMGFNRPSKIQEMALPMMLAHPPQN

gi|3108197|D.M._DBP5_A       PNSPLHSVKTFEALHLKASLLKGIYAMGFNTPSKIQETALPTLLADPPQN

gi|17536099|C.E._DBP5        PKSPLYSISSFRELRLKPEVLKALDTMNFQFPTRIQETALPLLLMEPPSN

gi|6324620|S.c._DBP5         PNSPLYSAKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRN

                             *.***:* .:*  * *  .:*:.: :* *: *::*** *** :* .** *

 

gi|15030051|M.M._DDX19       LIAQSQSGTGKTAAFVLAMLSRVEPADRYPQCLCLSPTYELALQTGKVIE

gi|13477371|H.S._DDX19       LIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIE

gi|38511690|M.M._DDX25       LIAQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVE

gi|61222937|H.S._DDX25       LIAQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVE

gi|3108197|D.M._DBP5_A       MIAQSQSGTGKTAAFVLAMLSRVNVCLNHPQVLCLSPTYELAIQTGEVAA

gi|17536099|C.E._DBP5        LIAQAQSGTGKTAAFVLTMLCRIDVNLMCPQCICLAPTLELAKQIGEVVE

gi|6324620|S.c._DBP5         MIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQ

                             :***:********** *:** *::     ** :**:*: *** *  .* 

 

gi|15030051|M.M._DDX19       QMGKFHPELKLAYAVRGNKLE--RGQKVSEQIVIGTPGTVLDWCSKLKFI

gi|13477371|H.S._DDX19       QMGKFYPELKLAYAVRGNKLE--RGQKISEQIVIGTPGTVLDWCSKLKFI

gi|38511690|M.M._DDX25       RMGKFCVDVEVMYAIRGNRIP--RGTEVTKQIIIGTPGTVLDWCFKRKLI

gi|61222937|H.S._DDX25       QMGKFCVDVQVMYAIRGNRIP--RGTDITKQIIIGTPGTVLDWCFKLKLI

gi|3108197|D.M._DBP5_A       RMGQFCREIKLRFAVRGEEVD--RSKKIEEHILIGTPGKLLDWGIKFRLF

gi|17536099|C.E._DBP5        KMGKFIDNLKIHYAIKGGNMAAMRGRKLTEQIVIGTPGITRDYLQKYKCI

gi|6324620|S.c._DBP5         EMGKFT-KITSQLIVP-DSFE--KNKQINAQVIVGTPGTVLDLMRR-KLM

                             .**:*  .:     :    .   :. .:  ::::****   *   : : :

 

gi|15030051|M.M._DDX19       DPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLP---RNCQMLLFSATFE

gi|13477371|H.S._DDX19       DPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLP---RNCQMLLFSATFE

gi|38511690|M.M._DDX25       DLTKIRVFVLDEADVMIDTQGFSDQSIRIQRALP---SECQMLLFSATFE

gi|61222937|H.S._DDX25       DLTKIRVFVLDEADVMIDTQGFSDHSIRIQRALP---SECQMLLFSATFE

gi|3108197|D.M._DBP5_A       DMKKISVFVLDEADVMIATQGHHDQCIRIHKMLN---PHCQMLFFSATYG

gi|17536099|C.E._DBP5        DPSKIRCLVLDEADVMIYHQGFTDISTTIYNMVEDASDSVQSMLFSATYD

gi|6324620|S.c._DBP5         QLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLP---KDTQLVLFSATFA

                             :  **  :****** *:  **  * .  : . :       * ::****:

 

gi|15030051|M.M._DDX19       DSVWKFAQKVVPDPNIIKLKREEETLDTIKQYYVLCNNREEKFQALCNLY

gi|13477371|H.S._DDX19       DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLY

gi|38511690|M.M._DDX25       DSVWQFAERIIPDPNVIKLRKEELTLNNIRQYYVLCENRKGKYQALCNIY

gi|61222937|H.S._DDX25       DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLCEHRKDKYQALCNIY

gi|3108197|D.M._DBP5_A       KEVMDFARLIVADPTIIRLMREEESLENIKQYYVKCKNEEGKYNAIQNIY

gi|17536099|C.E._DBP5        EPVINFATKIIKNAIVVMLKREEQALPNIKQFYVQCACRDSKYAAIVNLY

gi|6324620|S.c._DBP5         DAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELY

                             . * .:*  :: :.  : *  :*  :  *:* *: *  .  *: .: ::*

 

gi|15030051|M.M._DDX19       GAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIER

gi|13477371|H.S._DDX19       GAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIER

gi|38511690|M.M._DDX25       GGITIGQAIIFCQTRRNAKWLTVEMMQDGHQVSLLSGELTVEQRASIIQR

gi|61222937|H.S._DDX25       GSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELTVEQRASIIQR

gi|3108197|D.M._DBP5_A       GCISVGQAIIFCHTKRTAAWLAAKMTSDGHSVAVLTGDLTVVQRLDVLDR

gi|17536099|C.E._DBP5        SGLAVASSVIFCHTKASVMWLYENMRARGHQVDVLHGDMTVVERADTIIH

gi|6324620|S.c._DBP5         GLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDD

                             . :::..::**  *: ..  *  ::   **.* :* *:: . :*   : 

 

gi|15030051|M.M._DDX19       FREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGN-----------

gi|13477371|H.S._DDX19       FREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGN-----------

gi|38511690|M.M._DDX25       FRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVNQSEE-----------

gi|61222937|H.S._DDX25       FRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQGEE-----------

gi|3108197|D.M._DBP5_A       FRSGLEKVLITTNILSRGIDIEQLQVVVNFDLPVDLDGM-----------

gi|17536099|C.E._DBP5        FKRGDFKVLITTNVFARGIDVAQVSVVINYDLPIKYTDEGTPMVVDGFTQ

gi|6324620|S.c._DBP5         FREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQ-----------

                             *: *  ***:***: :****:  : :*:*:***                

 

gi|15030051|M.M._DDX19       PDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHF-NKKIERL

gi|13477371|H.S._DDX19       PDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHF-NKKIERL

gi|38511690|M.M._DDX25       PDYETYLHRIGRTGRFGKKGLAFNMIEVDK-LPLLMKIQDHF-NSNIKQL

gi|61222937|H.S._DDX25       PDYETYLHRIGRTGRFGKKGLAFNMIEVDE-LPSLMKIQDHF-NSSIKQL

gi|3108197|D.M._DBP5_A       ADCETYLHRIGRTGRFGKSGIAINLITDEKTMKVCSDIEKHF-NKKIEVL

gi|17536099|C.E._DBP5        PDCETYLHRIGRTGRFGKTGIAINLIDSEDSMNMINVLENHF-QMKIARM

gi|6324620|S.c._DBP5         ADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRV

                             .*  **:**********:           .       :   . :     .

 

gi|15030051|M.M._DDX19       DTDDLDEIEKIAN-----

gi|13477371|H.S._DDX19       DTDDLDEIEKIAN-----

gi|38511690|M.M._DDX25       DPEDMDEIEKIEY-----

gi|61222937|H.S._DDX25       NAEDMDEIEKIDY-----

gi|3108197|D.M._DBP5_A       NTDSADDIEKIGT-----

gi|17536099|C.E._DBP5        DPSNLVELEAIEMA----

gi|6324620|S.c._DBP5         PTDDWDEVEKIVKKVLKD

                                   . : :