S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dbp4p
YJL033W
Y23H5B.6 CG5800 DDX10 DDX10
Database Links
Cellular Function Ribosome biogenesis

Group Alignment

gi|27371129|M.M._Ddx10           MGKTVASLGQGTRPDP-----VRSFNRWKKKHSHRQHQKKERRKQLKKPE

gi|62739421|H.S._DDX10           MGKTANSPGSGARPDP-----VRSFNRWKKKHSHRQNKKKQLRKQLKKPE

gi|17509811|C.e.DBP4_DDX10_      MPHTNGK-GGGAQKWAGNNKRKRNFDGEQDPSVRKALKEKRLLKKRKQDL

gi|22832742|D.M._DBP4            MQRQKPK-GPG-KPGSRFKPGSGTFKGAGGGRKSGDNSQKRPRQEINKSR

gi|1170186|S.C._DBP4             -----------------------------------MAKKNRLNTTQRKTL

                                                                      .::.     .: 

 

gi|27371129|M.M._Ddx10           WQVEREGISRLMQNYEKIN---VNEITRFSDFPLSKKTLKGLQEAQYRLV

gi|62739421|H.S._DDX10           WQVERESISRLMQNYEKIN---VNEITRFSDFPLSKKTLKGLQEAQYRLV

gi|17509811|C.e.DBP4_DDX10_      KGQEETMLDEVEQKYQEMLKKSSRTFLRFEDFPLSWRTLEGLKDNDYTKP

gi|22832742|D.M._DBP4            LAATEAEIQDLKTKYAEID---ATAIKKFAQFPLSKKTQKALAESKFVHP

gi|1170186|S.C._DBP4             RQKEDEYIENLKTKIDEYDP-KITKAKFFKDLPISDPTLKGLRESSFIKL

                                        :. :  :  :           * ::*:*  * :.* : .:  

 

gi|27371129|M.M._Ddx10           TEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQWTSTDGL

gi|62739421|H.S._DDX10           TEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQWTSTDGL

gi|17509811|C.e.DBP4_DDX10_      TEIQRDTIAYSLTGSDVVGAAKTGSGKTLALVIPVLEALWRAKWSPDYGL

gi|22832742|D.M._DBP4            TQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLFMNKWSRTDGV

gi|1170186|S.C._DBP4             TEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEKLYREKWTEFDGL

                                 *::* ::*  :* * **:.** ********:::**:* *:  :*:   *:

 

gi|27371129|M.M._Ddx10           GVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGGKDLKHEAERINNIN

gi|62739421|H.S._DDX10           GVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGGKDLKHEAERINNIN

gi|17509811|C.e.DBP4_DDX10_      GALIISPTRELALQTFSTINAVGAHHGFSCGLVIGGSDVAFERNRISGIN

gi|22832742|D.M._DBP4            GAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKNLKFERTRMDQCN

gi|1170186|S.C._DBP4             GALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERISRIN

                                 *.:********* * :..:  :* : .**.**:***.:: .*  *:.  *

 

gi|27371129|M.M._Ddx10           ILVCTPGRLLQHMDETICFHATNLQMLVLDEADRILDMGFADTMNAIIEN

gi|62739421|H.S._DDX10           ILVCTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIEN

gi|17509811|C.e.DBP4_DDX10_      IIVCTPGRLLQHMDENAQMSCDSLQVLVLDEADRMLDMGFSKQLNSIINN

gi|22832742|D.M._DBP4            ILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIEN

gi|1170186|S.C._DBP4             ILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVST

                                 *:: ****:***:*:   :    :::******** ***** . :::::..

 

gi|27371129|M.M._Ddx10           LPKKRQTLLFSATQTKSVKDLARLSLKDPEYV-----WVHEKAKYST---

gi|62739421|H.S._DDX10           LPKKRQTLLFSATQTKSVKDLARLSLKNPEYV-----WVHEKAKYST---

gi|17509811|C.e.DBP4_DDX10_      LPAERQTLLFSATQTRNVKDLCRVCTNDPVFV-----SVHENASAAT---

gi|22832742|D.M._DBP4            FPPVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPSASTKKT

gi|1170186|S.C._DBP4             LSPSRQTLLFSATQSQSVADLARLSLTDYKTVG-----THDVMDGSVN--

                                 :.  **********:..* **.*:  .:   *       ::  . :.  

 

gi|27371129|M.M._Ddx10           --------PATLEQNYIICELHQKISVLFSFLRSHLKKKSIVFFSSCKEV

gi|62739421|H.S._DDX10           --------PATLEQNYIVCELQQKISVLYSFLRSHLKKKSIVFFSSCKEV

gi|17509811|C.e.DBP4_DDX10_      --------PDNLKQSYVIVEEEHKINALWSFIEAHRKKKSLVFVSSCKQA

gi|22832742|D.M._DBP4            PNTAVLAVPELLQQSYVVLNLEDKITMLWSFIKNHLKQKIIVFVASCKQA

gi|1170186|S.C._DBP4             ---KEASTPETLQQFYIEVPLADKLDILFSFIKSHLKCKMIVFLSSSKQV

                                         *  *:* *:     .*:  *:**:. * * * :**.:*.*:.

 

gi|27371129|M.M._Ddx10           QYLYRVFCRLRPGISILALHGRQQQMRRMEVYNEFVRKRAAVLFATDIAA

gi|62739421|H.S._DDX10           QYLYRVFCRLRPGVSILALHGRQQQMRRMEVYNEFVRKRAAVLFATDIAA

gi|17509811|C.e.DBP4_DDX10_      RFLTEAFSQLRPGLPVMGLWGTMNQKKRIETFTKFDESKAAVLIATDVAS

gi|22832742|D.M._DBP4            KYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVAS

gi|1170186|S.C._DBP4             HFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVA

                                 ::: . * :::** .:: * *  :*  *     .* .   . :::**:.:

 

gi|27371129|M.M._Ddx10           RGLDFPAVNWVLQFDCPEDANTYIHRAGRTARYKEDGEALLILLPSEEQG

gi|62739421|H.S._DDX10           RGLDFPAVNWVLQFDCPEDANTYIHRAGRTARYKEDGEALLILLPSE-KA

gi|17509811|C.e.DBP4_DDX10_      RGLDFEHIDWVIQVDCPAQIDDYIHRVGRSARMDDSGNSLLMVSPSQEEA

gi|22832742|D.M._DBP4            RGLDFPAVNWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVLTPSEEEY

gi|1170186|S.C._DBP4             RGIDFPAVDWVVQVDCPEDVDTYIHRVGRCARYGKKGKSLIMLTPQEQEA

                                 **:**  ::**:*.*** : . ****.** **    *:.*::: *.: :

 

gi|27371129|M.M._Ddx10           MVQQLLQKK-VPVKEIKINPEKLIDVQKKLESFLAQDQDLKERAQRCFVS

gi|62739421|H.S._DDX10           MVQQLLQKK-VPVKEIKINPEKLIDVQKKLESILAQDQDLKERAQRCFVS

gi|17509811|C.e.DBP4_DDX10_      MIGKLEKHS-IPIEELKIHPDAMSDVRVKLRAILAESQELKEYAQKSIVA

gi|22832742|D.M._DBP4            MISALKEQLNIDIRCVQIDPKKLFSPRVKIEAFLAQFPELRATAQRAFLS

gi|1170186|S.C._DBP4             FLKRLNARK-IEPGKLNIKQSKKKSIKPQLQSLLFKDPELKYLGQKAFIS

                                 ::  *  :  :    ::*. .   . : ::.::* :  :*:  .*:.:::

 

gi|27371129|M.M._Ddx10           YIRSVYLMKDKEVFNVSKLPITEYALSLGLAVAPRIRFLQKLEKQPSTEL

gi|62739421|H.S._DDX10           YVRSVYLMKDKEVFDVSKLPIPEYALSLGLAVAPRVRFLQKMQKQPTKEL

gi|17509811|C.e.DBP4_DDX10_      YLRSIYTMKDKKVFDVEAIDAAALADSFGLVSVPRVRFLNKKAKKSGEKL

gi|22832742|D.M._DBP4            YIKSVFLMRNKRLFNVFSLDLDAFAQSLGLAVTPRVPFLEKFLWRQKQLQ

gi|1170186|S.C._DBP4             YVRSIYVQKDKQVFKFDELPTEEFAYSLGLPGAPKIKMKGMKTIEQAKER

                                 *::*::  ::*.:*..  :     * *:**  .*:: :      .    

 

gi|27371129|M.M._Ddx10           VKNPVTEAVPPRAPSLPNDEADESPAYVSEKMSVLHKSGERLEETEHRLA

gi|62739421|H.S._DDX10           VRSQADKVIEPRAPSLTNDEVEEFRAYFNEKMSILQKGGKRLEGTEHRQD

gi|17509811|C.e.DBP4_DDX10_      MEKEVKEEEEEAS-LVGKFAIDE--------------DDEDIFTVKKP--

gi|22832742|D.M._DBP4            QQKEQGDNAKSINPLLSKLTKQQS--FGGGDEDEENSDDEDFIKVKRKDH

gi|1170186|S.C._DBP4             KNAPRQLAFLSKANEDGEVIEDKSKQPRTKYDKMFERKNQTILSEHYLNI

                                  .               :   ::               .: :   .   

 

gi|27371129|M.M._Ddx10           SGDGDEEQDEE------TEDEE-TEDHLGKAREPHTESVVSIEEAQKVKE

gi|62739421|H.S._DDX10           NDTGNEEQEEE------EDDEEEMEEKLAKAKGSQAPSLPNTSEAQKIKE

gi|17509811|C.e.DBP4_DDX10_      --TGEPEQIKE------EEAAEKISNITISKTKPLKKAVTKVSAAKKILN

gi|22832742|D.M._DBP4            DVEGEPVKLDE------EDDTENEAEAPLVVPK-REKLVTKASLAKKALK

gi|1170186|S.C._DBP4             TKAQAQEDEDDDFISVKRKDHEINEAELPALTLPTSRRAQKKALSKKASL

                                        . .:       .  *                  .   ::*  

 

gi|27371129|M.M._Ddx10           VSVQFLNRDDDDEDGPDADFLTVKRRDVFGLDLKE--NEALSKKEPSKSS

gi|62739421|H.S._DDX10           VPTQFLDRDEEEED---ADFLKVKRHNVFGLDLKD--EKTLQKKEPSKSS

gi|17509811|C.e.DBP4_DDX10_      KKLKVNTKKTFGAE--------DD--ELEELEEGP--STITS----YGLD

gi|22832742|D.M._DBP4            KNLQVNSKLKFDDEG---ETMADDRSQMKALSARQ--RTVNQDDDDGGIN

gi|1170186|S.C._DBP4             ASKGNASKLIFDDEG--------EAHPVYELEDEEEFHKRGDAEVQKTEF

                                        :     :         .   :  *.         .       

 

gi|27371129|M.M._Ddx10           VKKKLTKVAEAKKKK-----------------------------------

gi|62739421|H.S._DDX10           IKKKMTKVAEAKKVMKRNFKVNKKITFTDEGELVQQWPQMQKSAIKDAEE

gi|17509811|C.e.DBP4_DDX10_      IEKARQEIKSGDKEDRKRFKLLR---------------------------

gi|22832742|D.M._DBP4            LVLSKALLTEEDQYDKQRFRELV---------------------------

gi|1170186|S.C._DBP4             LTKESAVMADIDNIDKQVAKEKK---------------------------

                                 :      : . .:                                    

 

gi|27371129|M.M._Ddx10           --------------------------------------------------

gi|62739421|H.S._DDX10           DDDTGGINLHKAKERLQEEDKFDKEEYRKKIKAKHREKRLKEREARREAN

gi|17509811|C.e.DBP4_DDX10_      -----------------------------EQR---RQEKLAKKNRRAE--

gi|22832742|D.M._DBP4            -----------------------------KKRHKLQREKLRKKAEEAKGS

gi|1170186|S.C._DBP4             --------------------------------QEKKRKRLEAMRREMEAA

                                                                                  

 

gi|27371129|M.M._Ddx10           --------------------------------------------------

gi|62739421|H.S._DDX10           KRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDME

gi|17509811|C.e.DBP4_DDX10_      EEEAVEYDEDGS----EDE-------PDISWLPDPDAVRRKYEEEPDEVE

gi|22832742|D.M._DBP4            DDEEEQQDDDNA----DDAGSESDHSVDLSWLPDPDKVYKNKPNASDRNE

gi|1170186|S.C._DBP4             MEEEISGDEEEGKTVAYLGTGNLSDDMSDGDMPDSEGHLKKKARTVDYSH

                                                                                  

 

gi|27371129|M.M._Ddx10           --------------------------------------------------

gi|62739421|H.S._DDX10           NKISDTKKKQGMKKRSNSEVEDVGPTSHNRKKARWDTLEPLDTGLSLAED

gi|17509811|C.e.DBP4_DDX10_      DLEQQALAALGRK-------------------------------------

gi|22832742|D.M._DBP4            SKSESSDASDDEKADDSDGDDDDVSDDEPAYKK-----SKLTNKMTLMDT

gi|1170186|S.C._DBP4             GHNPSNSVDDDIIEVEEPQ--------------------------TLEDL

                                                                                  

 

gi|27371129|M.M._Ddx10           ------------

gi|62739421|H.S._DDX10           EELVLHLLRSQS

gi|17509811|C.e.DBP4_DDX10_      ------------

gi|22832742|D.M._DBP4            EAIAASLLGS--

gi|1170186|S.C._DBP4             ESLTAKLIQG--