S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dbp10p
YDL031W
Y94H6A.5 CG32344 / CG6994
LD28101p
DDX54 DDX54
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

gi|46576606|M.M._DDX54      ---------------------------MAAGRRVGPGPPSRPTMAPWKKK

gi|19110894|H.S._DDX54      ---------------------------MAADKGPAAGPRSRAAMAQWRKK

gi|25148614|C.E._DBP10      --------------------------------------------------

gi|18447311|D.M._DBP10      --------------------------------------------------

gi|6320173|S.c._DBP10       MAGVQKRKRDLEDQDDNGSEEDDIAFDIANEIALNDSESDANDSDSEVEA

                                                                              

 

gi|46576606|M.M._DDX54      R-LRKRRTGASQGRDSDSDDGEFEIQAEDDARARKLGPGRALPSFPTSEC

gi|19110894|H.S._DDX54      KGLRKRRGAASQARGSDSEDGEFEIQAEDDARARKLGPGRPLPTFPTSEC

gi|25148614|C.E._DBP10      -------------------------------------------------M

gi|18447311|D.M._DBP10      ---------------------------------MRKKQADEIPGFPSLDN

gi|6320173|S.c._DBP10       DYGPNDVQDVIEYSSDEEEGVNNKKKAENKDIKKKKNSKKEIAAFPMLEM

                                                                             

 

gi|46576606|M.M._DDX54      VSDVEPDTREMVRAQN--------------KKKKKSGGFQSMGLSYPVFK

gi|19110894|H.S._DDX54      TSDVEPDTREMVRAQN--------------KKKKKSGGFQSMGLSYPVFK

gi|25148614|C.E._DBP10      ASDDEEDFTQLQINQN--------------RKHKKAGGWQQIGLDHSVYK

gi|18447311|D.M._DBP10      DAGTSDRGADILKSKS--------------KKNK-SGGFQSMGLGFELIK

gi|6320173|S.c._DBP10       SDDENNASGKTQTGDDEDDVNEYFSTNNLEKTKHKKGSFPSFGLSKIVLN

                              . .    .    ..              :.::  *.: .:**.  : :

 

gi|46576606|M.M._DDX54      GIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTACFLLPMFERLK

gi|19110894|H.S._DDX54      GIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTACFLLPMFERLK

gi|25148614|C.E._DBP10      AIEKKGFNQPTPIQRKTIPCIMDGKDVVAMSRTGSGKTAAFVIPMLQKLK

gi|18447311|D.M._DBP10      GITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQ

gi|6320173|S.c._DBP10       NIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLK

                             * ::*:. ********** *::.:*:*.*::*******.*::*:.::*:

 

gi|46576606|M.M._DDX54      ARSAQTGARALILSPTRELALQTMKFTKELGKFTGLKTALILGGDKMEDQ

gi|19110894|H.S._DDX54      THSAQTGARALILSPTRELALQTLKFTKELGKFTGLKTALILGGDRMEDQ

gi|25148614|C.E._DBP10      RR-DTTGIRALMVSPTRELALQTFKVVKELGRFTGLRCACLVGGDQIEEQ

gi|18447311|D.M._DBP10      RREPTKGARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGDSMDSQ

gi|6320173|S.c._DBP10       SHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQ

                             :    * **:::**:****:** :. *::.:   *:   : *** ::.*

 

gi|46576606|M.M._DDX54      FAALHENPDIIIATPGRLVHVAVEMNLKLQSVEYVVFDEADRLFEMGFAE

gi|19110894|H.S._DDX54      FAALHENPDIIIATPGRLVHVAVEMSLKLQSVEYVVFDEADRLFEMGFAE

gi|25148614|C.E._DBP10      FSTIHENPDILLATPGRLLHVIVEMDLRLSYVQYVVFDEADRLFEMGFQD

gi|18447311|D.M._DBP10      FSAIHTCPDVIVATPGRFLHLCVEMDLKLNSIEYVVFDEADRLFEMGFGE

gi|6320173|S.c._DBP10       FGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQE

                            *. :   **:::*****::*: ***.* *. ::*************** :

 

gi|46576606|M.M._DDX54      QLQEIIGRLPGGHQTVLFSATLPKLLVEFARAGLTEPVLIRLDVDSKLNE

gi|19110894|H.S._DDX54      QLQEIIARLPGGHQTVLFSATLPKLLVEFARAGLTEPVLIRLDVDTKLNE

gi|25148614|C.E._DBP10      QLTETLKRIPESRQTLLFSATLPKMLVDFAKAGLTDPMLVRLDVDEKVSD

gi|18447311|D.M._DBP10      QLNETLHRLPSSRQTVMFSATLPKLLVEFARAGLNDPVLIRLDVESKLPD

gi|6320173|S.c._DBP10       QLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSE

                            ** * :  :*  :**::******: **:*.:*** :*:*:***.: *: :

 

gi|46576606|M.M._DDX54      QLKTSFLLVREDTKAAVLLYLLQN--------------------------

gi|19110894|H.S._DDX54      QLKTSFFLVREDTKAAVLLHLLHN--------------------------

gi|25148614|C.E._DBP10      KLSMVFCMCRPDEKLFALLHLCRNFCFKKLLETSLKKCKIS---------

gi|18447311|D.M._DBP10      ALALKFLYCRPDDRYTALVVLLKY--------------------------

gi|6320173|S.c._DBP10       NLEMLFLSSKNADREANLLYILQEIIKIPLATSEQLQKLQNSNNEADSDS

                             *   *   :   :   *: : :                           

 

gi|46576606|M.M._DDX54      ---------------------------VVRPQDQTVVFVATKHHAEYLTE

gi|19110894|H.S._DDX54      ---------------------------VVRPQDQTVVFVATKHHAEYLTE

gi|25148614|C.E._DBP10      ----------------KKKVPLLKKVRMDRENKQTVVFCATMKHVEYVVG

gi|18447311|D.M._DBP10      ---------------------------VIPVQSQTVVFAGTQHHVELISY

gi|6320173|S.c._DBP10       DDENDRQKKRRNFKKEKFRKQKMPAANELPSEKATILFVPTRHHVEYISQ

                                                           :. *::*  * :*.* : 

 

gi|46576606|M.M._DDX54      LLMGQGVSCAHIYSALDQTARKINLAKFTHNKCSTLIVTDLAARGLDIPL

gi|19110894|H.S._DDX54      LLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVTDLAARGLDIPL

gi|25148614|C.E._DBP10      ILHRAGIDCSFVYSQLDATARKMNIQKFHEKQNNILVVTDVAARGVDIPL

gi|18447311|D.M._DBP10      ILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGIDIPS

gi|6320173|S.c._DBP10       LLRDCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPM

                            :*       : :*. **  *** :  :*     . *:***:****:***

 

gi|46576606|M.M._DDX54      LDNVINYSFPAKGKLFLHRVGRVARAGRSGTAYSLVAPDEVPYLLDLHLF

gi|19110894|H.S._DDX54      LDNVINYSFPAKGKLFLHRVGRVARAGRSGTAYSLVAPDEIPYLLDLHLF

gi|25148614|C.E._DBP10      LDTVINLHFPPKAKLFVHRVGRVARAGRSGTAISLIANDELPYLTDLFMF

gi|18447311|D.M._DBP10      LDFVVNLHFPGKPKLFVHRVGRCARAGRTGTAYSIVSTDDTAHLLDLHLF

gi|6320173|S.c._DBP10       LANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELF

                            *  *:*  :* . *:*:***** ****..* * *::: :: .:* ** :*

 

gi|46576606|M.M._DDX54      LGRSVTLARPCEEPSVADAV-------------------GRDGVLGRVPQ

gi|19110894|H.S._DDX54      LGRSLTLARPLKEP--SGVA-------------------GVDGMLGRVPQ

gi|25148614|C.E._DBP10      LGKPINFASDKSEYK------------------------EDETLIGRVPD

gi|18447311|D.M._DBP10      LNRPFNIHDS--------------------------------SALGTIPQ

gi|6320173|S.c._DBP10       LGKKILLTPMYDSLVDVMKKRWIDEGKPEYQFQPPKLSYTKRLVLGSCPR

                            *.: . :                                     :*  *

 

gi|46576606|M.M._DDX54      SVVDDEDSSLQTAMGASLDLQGLHRVANNAQQQYVRSRPAPSPESIKRAK

gi|19110894|H.S._DDX54      SVVDEEDSGLQSTLEASLELRGLARVADNAQQQYVRSRPAPSPESIKRAK

gi|25148614|C.E._DBP10      SIVSLETEFFHSIHDNNEDMQDLRQKATNAMMKYTRTRPPPSAESARRVK

gi|18447311|D.M._DBP10      DLLEEEHLTVTDIK-KSHHIAGVLRTSENAYKKYLSSRPVASTDANARVK

gi|6320173|S.c._DBP10       LDVEGLGDLYKNLMSSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSK

                              :.            . .:    : : :*   *  :*. .*.::  * *

 

gi|46576606|M.M._DDX54      E----------------------LDLAELGLHPLFSSCFEEGELQ--RLR

gi|19110894|H.S._DDX54      E----------------------MDLVGLGLHPLFSSRFEEEELQ--RLR

gi|25148614|C.E._DBP10      QD-------------------IRTDSVECAPHPFLK---ADGDKQ--SND

gi|18447311|D.M._DBP10      KIKFFALKPLEDFFTAAPVLAQAAEASGQSTESQAKVSAAERKLQEEKHD

gi|6320173|S.c._DBP10       E------------------------IISSGWDAQNAFFGKNEEKE--KLD

                            :                            . ..       : . :    

 

gi|46576606|M.M._DDX54      LVDSIKNYRTRTTIFEINASSKDPSSQMMRAKRQRDRKAVASFQQR---R

gi|19110894|H.S._DDX54      LVDSIKNYRSRATIFEINASSRDLCSQVMRAKRQKDRKAIARFQQGQQGR

gi|25148614|C.E._DBP10      ILNKISQYKSRNTIFEMNKSQKSQALAVMQAKRKAHEPRISTVTEEKRKQ

gi|18447311|D.M._DBP10      ILVKMRSFRPGGTVFELNTTQKSTQFIVMKEKRMQHAEVINKFRQQ---R

gi|6320173|S.c._DBP10       FLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATER----

                            :: .: . :   *:**:. .  .    .*: :*           :     

 

gi|46576606|M.M._DDX54      QERQEGPADPAPQRELPQE------EEEEMVETVEGVF--------TEVV

gi|19110894|H.S._DDX54      QEQQEGPVGPAPSRPALQEKQPEKEEEEEAGESVEDIF--------SEVV

gi|25148614|C.E._DBP10      KEEKEQQQKSTDIAVEIAEKTVENAGEDELAEVFGTVIGSTKHTEKSEEK

gi|18447311|D.M._DBP10      AEEDIDEEKKTIEALNPSSGRMPTADEEAISSTFNKVV---------APK

gi|6320173|S.c._DBP10       -RELLEKERMAGLHILSKMKFWKGDDVETGYTVSEDALK-------EFED

                             ..       :                :         .           

 

gi|46576606|M.M._DDX54      GQKRPRPGPSQGAKRRRMETRQRDQEFYVPYRPKDFDSERGLSVSGAGGA

gi|19110894|H.S._DDX54      GRKRQRSGPNRGAKRRREEARQRDQEFYIPYRPKDFDSERGLSISGEGGA

gi|25148614|C.E._DBP10      GGKKRKIGTGKRIDRAEQMKFEREK-HYVPYMSSDHVAERHLALDTVD--

gi|18447311|D.M._DBP10      RLQNMDALYKDKPKKKKRKINSKDEDHYVPYQSADKHTEDGLAINN----

gi|6320173|S.c._DBP10       AHQLLEAQENENKKKKKPKSFKDPTFFLSHYAPAGDIQDKQLQITNG---

                              :          .: .    .    .   * . .   :  * :     

 

gi|46576606|M.M._DDX54      FEQQVAGAVLDLMGDEAQNMSRGQQQLK-WDRKKKRFVGQSGQED--KKK

gi|19110894|H.S._DDX54      FEQQAAGAVLDLMGDEAQNLTRGRQQLK-WDRKKKRFVGQSGQED--KKK

gi|25148614|C.E._DBP10      FARQAEGASVDIIMDDDRGMYQQKHGQR-WDRRLKKYVGLSGGNEPANKK

gi|18447311|D.M._DBP10      FERQAQNAEFSVSDRDLSQEVKHKPGLKKWDRIKKKMVSVQDPRA---NK

gi|6320173|S.c._DBP10       FANDAAQAAYDLNSDDKVQVHKQTATVK-WDKKRKKYVNTQGIDN--KKY

                            * .:.  *  .:   :     :     : **:  *: *. ..      :

 

gi|46576606|M.M._DDX54      IKTESGRFISSSYKRDLYQKWKQKQKIDDRDSEEE----GPSNQRGPGPR

gi|19110894|H.S._DDX54      IKTESGRYISSSYKRDLYQKWKQKQKIDDRDSDEE----GASDRRGP-ER

gi|25148614|C.E._DBP10      IRTEDGTWLPASYKTGKYEDWKQKQKIGFKKSDGG----GDD---GDNEG

gi|18447311|D.M._DBP10      IRTESGAWIPASFKTGRYAEWKEKSKIEDQLQREN----AGSDDENAKPL

gi|6320173|S.c._DBP10       IIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRETSIPSNLLEDPSQG

                            *  *.*  :.:*:: . : .*.:  ::              .   .   

 

gi|46576606|M.M._DDX54      RGGKRG--RSQ-GTSQPRASSVPAGRMRSELKTKEQILKQRRQAQ-----

gi|19110894|H.S._DDX54      RGGKRD--RGQAGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQ-----

gi|25148614|C.E._DBP10      SGGMDR--KRKWKMEKPKG-----GPKHSELKNKEQILKGRRKQEQLENY

gi|18447311|D.M._DBP10      SHAQRYPVSRHARHNLKLELKKRLTGNDKEMRRPEQIVKSR---------

gi|6320173|S.c._DBP10       PAANGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSG------

                              .       :   .                   ::: *          

 

gi|46576606|M.M._DDX54      -----------KQRFLQRGGLKQLSARNRRRAQELRQGAFGRGAPSRK--

gi|19110894|H.S._DDX54      -----------KLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKK--

gi|25148614|C.E._DBP10      MEHRRQSNLKKKAEHLGRGGAGGARGGARGGARGGARGGSSRGARGGARG

gi|18447311|D.M._DBP10      ----------MRLEFIKKRNEENAERKSENRKRSMRKTQRPKAQSTGG--

gi|6320173|S.c._DBP10       ------------ISVKGYNNAPGLRSELKSTEQIRKDRIIAEKKRAKNAR

                                               .        .   :        .       

 

gi|46576606|M.M._DDX54      -GKMRKRM

gi|19110894|H.S._DDX54      -GKMRKRM

gi|25148614|C.E._DBP10      GGKFGNRR

gi|18447311|D.M._DBP10      -SKRRK--

gi|6320173|S.c._DBP10       PSKKRKF-

                             .*  :