S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein H27M09.1 abstrakt
CG14637
DDX41 DDX41
Database Links
Cellular Function

Group Alignment

gi|15030112|gb|AAH11308.1|[Mus      ------MEDSEPERKRARADEATAGGSR------SEDEDEDDEDYVPYVP

gi|20532370|sp|Q9UJV9|ABS_HUMA      ------MEESEPERKRARTDEVPAGGSR------SEAEDEDDEDYVPYVP

gi|17977678|ref|NP_524220.1|        ------MAHVKRYRRSSKS---------------SEEGDLDNEDYVPYVP

gi|7206748|gb|AAF39907.1|           MSTDVEAARRKYEDRRRKIQEEEMKERRDGMNLSSGDDDQDVDDMFLTAL

                                              :   :  :                *   * * :* .  .

 

gi|15030112|gb|AAH11308.1|[Mus      LRQRRQLLLQKLLQRRRKGATEEEQQDSGSEPRGDEDD------IPLGPQ

gi|20532370|sp|Q9UJV9|ABS_HUMA      LRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDD------IPLGPQ

gi|17977678|ref|NP_524220.1|        VKERKKQHMIKLG-RIVQLVSETAQPKSSSENENEDDSQGAHDVETWGRK

gi|7206748|gb|AAF39907.1|           QRKREKVHRRALLKQVLAPTMNQKEEIERKRKKKEEDK--------QSEE

                                     ::*.:     *  :    . :  :  . .. . ::*.         . :

 

gi|15030112|gb|AAH11308.1|[Mus      SNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESVAEGRALMSVKEM

gi|20532370|sp|Q9UJV9|ABS_HUMA      SNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESVAEGRALMSVKEM

gi|17977678|ref|NP_524220.1|        YNISLLDQHTELKKIAEAKKLSAVEKQLREEEKIMESIAQQKALMGVAEL

gi|7206748|gb|AAF39907.1|           ARKTLLEKHAEIMETQGVIDES--ERQLMEEEELLDKVTRGGGLLAVAEL

                                     . :**::* .: :   . . *  *:** ***::::.::.  .*:.* *:

 

gi|15030112|gb|AAH11308.1|[Mus      AKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKS

gi|20532370|sp|Q9UJV9|ABS_HUMA      AKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKS

gi|17977678|ref|NP_524220.1|        AKGIQYEQPIKTAWKPPRYIREMSEEEREAVRHELRILVEGETPSPPIRS

gi|7206748|gb|AAF39907.1|           TKGEKYEEPIVTAWRPPGHIRRQSQEDYEIQRKRLGISCEGDHIPPPIGS

                                    :**  *::** *:* ** ::   *:*  *  *:.  *  **:  .*** *

 

gi|15030112|gb|AAH11308.1|[Mus      FKEMKFPAAILRGLKK-KGILHPTPIQIQGIPTILSGRDMIGIAFTGSGK

gi|20532370|sp|Q9UJV9|ABS_HUMA      FKEMKFPAAILRGLKK-KGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGK

gi|17977678|ref|NP_524220.1|        FREMKFPKGILNGLAA-KGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGK

gi|7206748|gb|AAF39907.1|           FLEMKFPKSLLEFMQKQKGIVTPTAIQIQGIPVALSGRDMIGIASTGSGK

                                    * ***** .:*. :   ***  **.**:**:*. *:***:**** *****

 

gi|15030112|gb|AAH11308.1|[Mus      TLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYC

gi|20532370|sp|Q9UJV9|ABS_HUMA      TLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYC

gi|17977678|ref|NP_524220.1|        TLVFVLPVIMFALEQEYSLPFERNEGPYGLIICPSRELAKQTHEIIQHYS

gi|7206748|gb|AAF39907.1|           TMTFVLPLVMFCLEQEMKLPFMRSEGPFGLIIVPSRELARQIFDLIIEMF

                                    *:.*.**::**.****  *** : ***:**** ******:* . ::   

 

gi|15030112|gb|AAH11308.1|[Mus      RLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKK

gi|20532370|sp|Q9UJV9|ABS_HUMA      RLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKK

gi|17977678|ref|NP_524220.1|        KHLQACGMPEIRSCLAMGGLPVSEALDVISRGVHIVVATPGRLMDMLDKK

gi|7206748|gb|AAF39907.1|           DALGKAGLPEMRAGLCIGGVPIGEQAKDVRDGIHIVVATPGRLSDMLTKK

                                      *   . * :*. *.:**:.: *  . :  *:*::******* *:* **

 

gi|15030112|gb|AAH11308.1|[Mus      MVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKK

gi|20532370|sp|Q9UJV9|ABS_HUMA      MVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKK

gi|17977678|ref|NP_524220.1|        ILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKK

gi|7206748|gb|AAF39907.1|           IINLEVCRYLVLDEADRMLDMGFEDEIKSIFYFFKAQRQTLLFSATMPRK

                                    ::.*::**** :******:***** ::::** :**.************:*

 

gi|15030112|gb|AAH11308.1|[Mus      IQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAKMVYLLECLQKT

gi|20532370|sp|Q9UJV9|ABS_HUMA      IQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAKMVYLLECLQKT

gi|17977678|ref|NP_524220.1|        IQNFARSALVKPVTINVGRAGAASMNVTQQVEYVKQEAKVVYLLDCLQKT

gi|7206748|gb|AAF39907.1|           IQFFAKSALVKPIVVNVGRAGAASLNVLQELEFVRSENKLVRVLECLQKT

                                    ** **:******:.:*********::* *::*:*:.* *:* :*:*****

 

gi|15030112|gb|AAH11308.1|[Mus      PPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREG

gi|20532370|sp|Q9UJV9|ABS_HUMA      PPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREG

gi|17977678|ref|NP_524220.1|        APPVLIFAEKKQDVDCIHEYLLLKGVEAVAIHGGKDQEERSRAVDAYRVG

gi|7206748|gb|AAF39907.1|           SPKVLIFAEKKVDVDNIYEYLLVKGVEVASIHGGKDQSDRHAGIEAFRKN

                                    .* ******** *** *:****:****..:*******.:*  .::*:* .

 

gi|15030112|gb|AAH11308.1|[Mus      KKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGI

gi|20532370|sp|Q9UJV9|ABS_HUMA      KKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGI

gi|17977678|ref|NP_524220.1|        KKDVLVATDVASKGLDFPNVQHVINYDMPDDIENYVHRIGRTGRSNTKGL

gi|7206748|gb|AAF39907.1|           EKDVLVATDVASKGLDFQGIEHVINFDMPEDIENYVHRIGRTGRSGRKGL

                                    :****************  ::****:***::**************. .*:

 

gi|15030112|gb|AAH11308.1|[Mus      ATTFINKACDESVLMDLKALLLEAKQKVPPGLQVLHCGDE--SMLDIGGE

gi|20532370|sp|Q9UJV9|ABS_HUMA      ATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDE--SMLDIGGE

gi|17977678|ref|NP_524220.1|        ATTLINKTTEQSVLLDLKHLLIEGKQEVPDFLDELAPETEH-QHLDLGDS

gi|7206748|gb|AAF39907.1|           ATTFINKKSEMSVLSDLKQLLAEAGQELPEFLKMLAGDEEGTAPAGTNAE

                                    ***:***  : *** *** ** *. *::*  *. *    *     . . .

 

gi|15030112|gb|AAH11308.1|[Mus      RGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF

gi|20532370|sp|Q9UJV9|ABS_HUMA      RGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF

gi|17977678|ref|NP_524220.1|        HGCTYCGGLGHRITECPKLEAVQNKQASNIGRRDYLSNTAADY

gi|7206748|gb|AAF39907.1|           KGCAYCSGLGHRITDCPKLAGIGNKTTQALARG---GGDDGGF

                                    :**::*.*******:**** .: .* .. :.*    .    .: