S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dna2p
YHR164C
Dna-2
CG2990
Dna2
CG2990
Dna2L DNA2L
Database Links
Cellular Function DNA repair

Group Alignment

Dna2_H.s.     MKTPCIPSPKQGSKGRGQSPAAQVRGPTW-------------------------------

Dna2_M.m.     ------------------------------------------------------------

Dna_D.m.      ------------------MATKRVLTPNILEND---------------------------

Dna2_C.e.     MSAARPPVASYFAARIAVPCETTAVETPLSLGD---------------------------

YHR164C_S.c.  --MPGTPQKNKRSASISVSPAKKTEEKEIIQNDSKAILSKQTKRKKKYAFAPINNLNGKN

 

 

Dna2_H.s.     --------------------------------------NAPAREGRPGAGHLGHLRVGAC

Dna2_M.m.     ------------------------------------------------------------

Dna_D.m.      --------------------------------------NTDVTSSNPQKKFKEQLDFSSD

Dna2_C.e.     ------------------------------GVSQKTAPKCQFRITRAETSKRGIQGFGSG

YHR164C_S.c.  TKVSNASVLKSIAVSQVRNTSRTKDINKAVSKSVKQLPNSQVKPKREMSNLSRHHDFTQD

 

 

Dna2_H.s.     ARGAQARAFFPFLSFLCYPRFRCLFCLQFAIPASRME-----------------------

Dna2_M.m.     -----------------------------------ME-----------------------

Dna_D.m.      E---VENIDWG-------------------------------------------------

Dna2_C.e.     TEHDGDSVD-----------SFENFCPTASSPKEKIS-----------------------

YHR164C_S.c.  EDGPMEEVIWKYSPLQRDMSDKTTSAAEYSDDYEDVQNPSSTPIVPNRLKTVLSFTNIQV

 

 

Dna2_H.s.     QLNELEL-LMEKSFWEEAEL-PAELFQKKVV-----------------------ASFPRT

Dna2_M.m.     PLDELDLLLLEEDGGAEAVP-RVELLRKKAD-----------------------ALFPET

Dna_D.m.      DNDDFDLALIAAM--DSISNHRLELTKWQRC-----------------------------

Dna2_C.e.     PRSRSERIQLQECDDDDSFDAPVISSKPPAL-----------------PKDSGVSGFPCL

YHR164C_S.c.  PNADVNQ-LIQENGNEQVRPKPAEISTRESLRNIDDILDDIEGDLTIKPTITKFSDLPSS

 

 

Dna2_H.s.     VL--------------------STG------------MDNRY---------LVLAVNTVQ

Dna2_M.m.     VL--------------------SRG------------VDNRY---------LVLAVETSQ

Dna_D.m.      ---------------------------------------------------EVVRLEQLP

Dna2_C.e.     -------------------------------------FDDK----------NVIHLTARK

YHR164C_S.c.  PIKAPNVEKKAEVNAEEVDKMDSTGDSNDGDDSLIDILTQKYVEKRKSESQITIQGNTNQ

 

 

Dna2_H.s.     ---------------------------------------NKEGNCEK-------------

Dna2_M.m.     ---------------------------------------NERGAEEK-------------

Dna_D.m.      ---------------------------------------NRKGL----------------

Dna2_C.e.     --------------------------------------GEKRDDC---------------

YHR164C_S.c.  KSGAQESCGKNDNTKSRGEIEDHENVDNQAKTGNAFYENEEDSNCQRIKKNEKIEYNSSD

 

 

Dna2_H.s.     ------------------------------------------------------------

Dna2_M.m.     ------------------------------------------------------------

Dna_D.m.      ------------------------------------------------------------

Dna2_C.e.     ------------------------------------------------------------

YHR164C_S.c.  EFSDDSLIELLNETQTQVEPNTIEQDLDKVEKMVSDDLRIATDSTLSAYALRAKSGAPRD

 

 

Dna2_H.s.     ---RLVITASQSLENKEL-----------------CILRNDWCSVPVEPGDIIHLEG--D

Dna2_M.m.     ---RLHVTASQDREHEVL-----------------CILRNGWSSVPVEPGDIVHLEG--D

Dna_D.m.      ---KVHVKRISGGDPETA----------------DCQLLPPWNCMPMQVGDTVSLLGKWD

Dna2_C.e.     ----LDLECIDKEGTTRI-----------------VYLQDHWSEMSIEAGSTINLIGAQA

YHR164C_S.c.  GVVRLVIVSLRSVELPKIGTQKILECIDGKGEQSSVVVRHPWVYLEFEVGDVIHIIEGKN

 

 

Dna2_H.s.     CTSDTWIIDK--------DFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRSS-DPAT

Dna2_M.m.     CTSEPWIIDD--------DFGYFILYPDMMISGTSVASSIRCLRRAVLSETFRGS-DPAT

Dna_D.m.      PSAGCYVVDK--------EQGYCVSHPDFLISGTTVTGSLFCKRKSVLQERFRGL--DSG

Dna2_C.e.     WGDRDFLVND--------DVGIVILNPDALVPCTAVASATFCARKTVLNDKFKFG-NASN

YHR164C_S.c.  IENKRLLSDDKNPKTQLANDNLLVLNPDVLFSATSVGSSVGCLRRSILQMQFQDPRGEPS

 

 

Dna2_H.s.     RQMLIGTVLHEVFQKAINNSFAPEKLQELA-FQTIQEIRHLKEMYRLNLSQDEIKQE---

Dna2_M.m.     RQMLIGTILHEVFQKAISESFAPERLQELA-LQTLREVRHLKEMYRLNLSQDEILCE---

Dna_D.m.      NSMVIGTLVHELLQKVLRQKLFDKKHIQSA----LQEMLASSSLAHLLYASNLIQVE---

Dna2_C.e.     KAMLLGTIMHEIFQTAITSKKRPVMENDLMKIWNKQAPKYAEELVALSFTPSCLDAE---

YHR164C_S.c.  LVMTLGNIVHELLQDSIKYKLSHNKISMEIIIQKLDSLLETYSFSIIICNEEIQYVKELV

 

 

Dna2_H.s.     VEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPR

Dna2_M.m.     VEEYLPSFSKWAEDFMRKGPSSEFPQMQLSLPSDGSNRSSPCNIEVVKSLDIEESIWSPR

Dna_D.m.      MEDHLMKFIDPIVSFVAQYVKGEPPSVLL---------PEVYRGQIHEICDIEENLWVPQ

Dna2_C.e.     LQPYFSIICGWINKHYPLSNSF-----------FSKREPLPSKSELLEVYDIEENIWDSK

YHR164C_S.c.  MKEHAENILYFVNKFVSKSNYGCYTSI------SGTRRTQP--ISISNVIDIEENIWSPI

 

 

Dna2_H.s.     FGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRADPE

Dna2_M.m.     FGLKGKIDVTVGVKIHRDCKMKYKVMPLELKTGKESNSIEHRSQVVLYTLLSQERREDPE

Dna_D.m.      LGLKGKVDVSVKVKNQRQ---REEIIPLELKTGRASFSMEHKGQLLLYQLMHSAQGRDTQ

Dna2_C.e.     LGLKGKIDVTMRTKSRGG------MESLELKTGKSSCSSEHTGQVLLYCMMQSSRYEQPI

YHR164C_S.c.  YGLKGFLDATVEANVENN---KKHIVPLEVKTGK-SRSVSYEVQGLIYTLLLNDRYEIPI

 

 

Dna2_H.s.     A-GLLLYL-KTGQMYPVPANHLDKRELLKLRNQMAFSLFHRISKSATRQKT-QLASLPQI

Dna2_M.m.     A-GWLLYL-KTGQMYPVPANHLDKRELLKLRNWLAASLLHRVSRAAPGEEA-RLSALPQI

Dna_D.m.      S-GLLLYL-KEGLLREVASGRNEQRDLLMLRNDLAYWLTREVAIPASKEDPLEQLPLPEP

Dna2_C.e.     GPGNILYL-KDGASHCVTPRAADLLGVLQQRNKLSVHF----------EDP-TTSNLPDP

YHR164C_S.c.  E-FFLLYFTRDKNMTKFPSVLHSIKHILMSRNRMSMNFKHQLQEVFGQAQS--RFELP-P

 

 

Dna2_H.s.     IEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPIVMLPKIEEETQHLKQT---HLEYFSL

Dna2_M.m.     IEEEKTCKYCSQIGNCALYSRAVEEQGDDASIPEAMLSKIQEETRHLQLA---HLKYFSL

Dna_D.m.      VYHHSACGNCAYNTICSSFAQKDSSLQLSDSHP--LKKLMPQLLEHLSEA---DHAYVQH

Dna2_C.e.     RQDSRFCDKCDHKTMCSFYQKTEENFSKSNDK---MKNFAENEMAHLEQN---HIEYAAN

YHR164C_S.c.  LLRDSSCDSCFIKESCMVLNKLLEDGTPEESGL--VEGEFEILTNHLSQNLANYKEFFTK

 

 

Dna2_H.s.     WCLMLTLESQSKDNK--KNHQNIWLMPASEME-KSGSCIGNLIRMEHVKIVC-DGQYLHN

Dna2_M.m.     WCLMLTLESQSKDNR--KTHQSIWLTPASELE-ESGNCVGNLVRTEPVSRVC-DGQYLHN

Dna_D.m.      WCGLLALEEQHNRQS--SHVRSFWTKDPAERE-KEGIAIRHLKLVKGQEVILEEGRYRQT

Dna2_C.e.     WIRWISAEWKCERERMTSQNKDLWLKSVQERV-EEGTCLSDLHPVS--EEMSNSQKIIIS

YHR164C_S.c.  YNDLITKEESSIT----CVNKELFLLDGSTRESRSGRCLSGLVVSEVVEHEKTEGAYIYC

 

 

Dna2_H.s.     FQCKHG-----AIPVTNLMAGDRVIVSGEERSLFALSRGYVKEI--NMTTVTCLLDRNL-

Dna2_M.m.     FQRKNG-----PMPATNLMAGDRIILSGEERKLFALSKGYVKKM--NKAAVTCLLDRNL-

Dna_D.m.      LELGEEADPSRDLSLSGFDLGEYVVISSTSR--LAVAAGFIVSI--EARRLDLRLERDL-

Dna2_C.e.     FSRKFL----KSSNTPTFRPGDVCLLSNKKH--IAIGFALIDEVSDDQQIVKISTDKTI-

YHR164C_S.c.  FSRRRNDNNSQSMLSSQIAANDFVIISDEEGH-FCLCQGRVQFI--NPAKIGISVKRKLL

 

 

Dna2_H.s.     ------------------------SVLPEST---LFRLDQEEKNCDIDTPLGNLSKLM--

Dna2_M.m.     ------------------------STLPATT---VFRLDREERHGDISTPLGNLSKLM--

Dna_D.m.      ------------------------SQRYSEE---TFIIDKHDSQSFATFNFTNLGMLL--

Dna2_C.e.     ------------------------KSRYEAP----FHLDKYTSMSTHSTTLGNLVYLL--

YHR164C_S.c.  NNRLLDKEKGVTTIQSVVESELEQSSLIATQNLVTYRIDKNDIQQSLSLARFNLLSLFLP

 

 

Dna2_H.s.     ----------ENTFVSKK----------LRDLIIDFREPQFI-SYLSSVLPHDAKDTVAC

Dna2_M.m.     ----------ESTDPSKR----------LRELIIDFREPQFI-AYLSSVLPHDAKDTVAN

Dna_D.m.      ----------SEGERFQE----------LRDIIVAKKPPE-----QHKVLPKIILTKGAP

Dna2_C.e.     ----------QNDEIGKR----------LRNILVDLLPPIIMDATGFNLTPAIKKIIIK-

YHR164C_S.c.  AVSPGVDIVDERSKLCRKTKRSDGGNEILRSLLVDNRAPKFRDANDDPVIPYKLSKDTT-

 

 

Dna2_H.s.     ILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGFSVLLTSYTHSA

Dna2_M.m.     ILKGLNKPQRQAMKRVLLSKDYTLIVGMPGTGKTTTICALVRILSACGFSVLLTSYTHSA

Dna_D.m.      ILLNLNKVQQNAALRALTTSSHLLIKGLPGTGKTQTLVALVRLLHLLGKSVLITAQTHSA

Dna2_C.e.     --AKLNNEQRKAVVHALATEDFMMVEGLPGSGKTTLISVLIQCLVATNKKVLLAAFTHSA

YHR164C_S.c.  ----LNLNQKEAIDKVMRAEDYALILGMPGTGKTTVIAEIIKILVSEGKRVLLTSYTHSA

 

 

Dna2_H.s.     VDNILLKLAKFKIG--FLRLGQIQKVHPAIQQFT-EQEICRSKSIKSLALLEELYNSQLI

Dna2_M.m.     VDNILLKLAKFKVG--FLRLGQSHKVHPDIQKFT-EEEICRSRSIASLAHLEELYNSHPI

Dna_D.m.      VDNLIMRLLPFGLP--MMRLGSGSRIHKQLEEIS-EERL--TKDCKTVEELEKALGQPSI

Dna2_C.e.     VDNILTKLTKEVAAEKILRLGSSSSIKDDIKKMTLKAKLENETSEEYYAAVRKVMKTTPI

YHR164C_S.c.  VDNILIKLRNTNIS--IMRLGMKHKVHPDTQKY-----VPNYASVKSYNDYLSKINSTSV

 

 

Dna2_H.s.     VATTCMGI-NHPIFS--RKIFDFCIVDEASQISQPICLGPLFFSRRFVLVGDHQQLPPLV

Dna2_M.m.     VATTCMGI-NHPIFS--RKTFDFCIVDEASQISQPVCLGPLFFSRRFVLVGDHQQLPPLV

Dna_D.m.      VGVTCLGC-GHPLFQ--RRQFDYCIVDEATQVLQPTVLRPLIHCSKFVLVGDPEQLPPIV

Dna2_C.e.     VACTCHHVPRELLFS--YRHFDVVIVDEASMVLEPLLLPVLATSNKFVLVGDCKQLTPLV

YHR164C_S.c.  VATTCLGI-NDILFTLNEKDFDYVILDEASQISMPVALGPLRYGNRFIMVGDHYQLPPLV

 

 

Dna2_H.s.     LNREARALGMSESLFKRLEQNKSAVV-QLTVQYRMNSKIMSLSNKLTYEGKLECGSDKVA

Dna2_M.m.     VNREARALGMSESLFKRLERNESAVV-QLTVQYRMNRKIMSLSNKLTYAGKLECGSDRVA

Dna_D.m.      RSKEARQRGADETLFQRLDSEKATAV--LSLQYRMNKTITRLANELTYGGDLKCASDEVS

Dna2_C.e.     VSRKAKQEGAGISTMEKLQQSHPGVVVSLTSQYRMNREISVLSSKLFYENRLICGNESVS

YHR164C_S.c.  KNDAARLGGLEESLFKTFCEKHPESVAELTLQYRMCGDIVTLSNFLIYDNKLKCGNNEVF

 

 

Dna2_H.s.     NAVINLRHFKDVKLELEF--------------YADYSDN--PWLMGVFEPNNPVCFLNT-

Dna2_M.m.     NAVLALPNLKDARLSLQL--------------YADYSDS--PWLAGVLEPDNPVCFLNT-

Dna_D.m.      GARFEVELLNEAPRWVQRALTTHLEQAVTLINTGDCLERCQEFVYASQRLVDTCSSIEQS

Dna2_C.e.     RSSLDR-----TGDYIVA--------------MDDGSDHIRKALSG--DIKDSCVFLDTQ

YHR164C_S.c.  AQSLELP----MPEALSR--------------YRNESANSKQWLEDILEPTRKVVFLNY-

 

 

Dna2_H.s.     ---DKVPAPEQVEKGGVS---NVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIIN

Dna2_M.m.     ---DKVPAPEQVENGGVS---NVTEARLIVFLTSTFIKAGCSPSDIGVIAPYRQQLRIIS

Dna_D.m.      FSEDKDEIRKLTSKKRVSKYTNYCEAGIVMHLLRYLLKSGYEASRIGVIAPYRAQVELFK

Dna2_C.e.     STINSKMQCEDGEGGGMC---NDGEAKLISELCQQFVMSGVKPHEIGVMSAYRRQVDHIR

YHR164C_S.c.  --DNCPDIIEQSEKDNIT---NHGEAELTLQCVEGMLLSGVPCEDIGVMTLYRAQLRLLK

 

 

Dna2_H.s.     DLLAR-SIGMVEVNTVDKYQGRDKSIVLVSFVRSNKD------GTVGELLKDWRRLNVAI

Dna2_M.m.     DLLARSSVGMVEVNTVDKYQGRDKSLILVSFVRSNED------GTLGELLKDWRRLNVAL

Dna_D.m.      KLASK-LDTDLECNTVDQFQGRDKNLIIYSCSKTGGDFSDMERSREAEILEDQRRLTVAI

Dna2_C.e.     GILNS---DELEVNTIDSYQGREKRVIIWSLTWTNNS------TKKSELLKDERRVNVAL

YHR164C_S.c.  KIFNKNVYDGLEILTADQFQGRDKKCIIISMVRRNSQ------LNGGALLKELRRVNVAM

 

 

Dna2_H.s.     TRAKHKLILLGCVPSLNCYPPLEKLLNHLNSEKLIIDL----------PSR---------

Dna2_M.m.     TRAKHKLILLGSVSSLKRFPPLGTLFDHLNAEQLILDL----------PSR---------

Dna_D.m.      TRAKNKLILLGDIKCLEQYGPFRQLFKHI-------------------PDR---------

Dna2_C.e.     TRARQKLVVVGCKNSAETIPVLFRFSQLIE------------------------------

YHR164C_S.c.  TRAKSKLIIIGSKSTIGSVPEIKSFVNLLEERNWVYTMCKDALYKYKFPDRSNAIDEARK

 

 

Dna2_H.s.     -------------------EHESLCHILGDFQRE

Dna2_M.m.     -------------------EHESLSHILGDCQRD

Dna_D.m.      -------CRLKLEEGRMEFGWQRIQEDLVGLMDT

Dna2_C.e.     -------------------NHISIPTQL------

YHR164C_S.c.  GCGKRTGAKPITSKSKFVSDKPIIKEILQEYES-